Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03542
Gene name
Locationscaffold_03:3002010..3003583
Strand-
Gene length (bp)1573
Transcript length (bp)1431
Coding sequence length (bp)1431
Protein length (aa) 477

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00344 SecY SecY 1.1E-70 76 457
PF10559 Plug_translocon Plug domain of Sec61p 1.9E-15 41 75

GO

GO Term Description Terminal node
GO:0015031 protein transport Yes
GO:0016020 membrane Yes
GO:0005575 cellular_component No
GO:0051641 cellular localization No
GO:0051179 localization No
GO:0008104 protein localization No
GO:0071702 organic substance transport No
GO:0071705 nitrogen compound transport No
GO:0008150 biological_process No
GO:0033036 macromolecule localization No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0045184 establishment of protein localization No
GO:0070727 cellular macromolecule localization No
GO:0110165 cellular anatomical entity No
GO:0051234 establishment of localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.5

Transmembrane Domains

Domain # Start End Length
1 34 56 22
2 76 98 22
3 119 141 22
4 145 167 22
5 174 195 21
6 241 263 22
7 283 305 22
8 354 376 22
9 416 435 19
10 439 461 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03542
MSSLRFLDLVKPFVPFLPEVQQPETKIPFNQKMMWTALTLLIFLVMSQMPLYGIVSSDNSDPLYWLRMVIASNRG
TLMELGITPIISSGMVFQLLAGTHMIDVNLDLKSDRELYQTAQKLFAFILSAGTATVYVFTGLYGPPSDLGAGIV
FLLILQLVVAGMIVILLDELLQKGYGLGSGISLFIATNICESIMWKAFSPTTINTGRGPEFEGAVIALFHLLMTW
PNKQRALQEAFYRQNLPNIMNLLATILVFVAVIYLQGFRVEIPVKSSRQRGARGSYPVRLFYTSNMPIMLQSALS
SNIFLISQMLYSRFSENLLVRLFGVWEAKDGSSQLYAASGLAYYMSPPLNFKDALLDPIHTAAYIVYMLGACALF
SKTWIEVSGSSPRDVAKQLKDQGLVMAGHRDQSMYKELKRIIPTAAAFGGACIGALSVASDLMGALGSGTGTLLA
VTIIYGYFEIAAKEGDLSGMKGMIMG*
Coding >Ophcf2|03542
ATGAGCTCTTTGCGATTTCTCGACCTGGTGAAGCCATTCGTGCCGTTCCTCCCTGAGGTGCAGCAGCCGGAGACC
AAGATTCCCTTCAACCAGAAGATGATGTGGACGGCTTTGACGCTCCTCATCTTTCTAGTCATGAGTCAGATGCCG
CTGTATGGCATCGTCTCGTCGGATAATTCGGATCCGCTATACTGGCTGCGGATGGTCATCGCCAGTAATCGAGGC
ACGCTCATGGAATTGGGCATCACGCCCATCATCTCTTCTGGCATGGTCTTTCAGCTGCTCGCCGGCACGCACATG
ATCGATGTCAACCTCGACCTCAAGTCGGATCGTGAGCTCTACCAGACGGCTCAGAAGCTCTTTGCCTTTATCCTC
TCGGCCGGCACTGCCACCGTCTACGTCTTCACTGGCCTCTACGGCCCGCCCTCGGATCTTGGCGCCGGCATCGTC
TTCCTTCTCATCTTGCAGCTCGTCGTCGCCGGAATGATTGTCATCCTTCTCGATGAGCTGTTGCAAAAGGGATAC
GGCCTTGGCAGCGGCATCTCCCTCTTCATCGCCACCAACATTTGCGAGTCCATCATGTGGAAGGCCTTTTCGCCC
ACCACCATCAATACCGGCCGCGGCCCCGAGTTCGAAGGCGCCGTCATTGCCCTCTTCCACCTGCTCATGACTTGG
CCCAACAAGCAGCGCGCTCTGCAGGAGGCCTTTTACAGGCAGAACCTCCCCAACATCATGAACCTGCTCGCCACC
ATCCTCGTCTTCGTCGCCGTCATCTACCTGCAGGGCTTCCGCGTCGAGATCCCCGTCAAGTCGTCCCGTCAGCGC
GGCGCTCGTGGCTCTTACCCGGTCCGCCTCTTCTACACGTCCAACATGCCCATCATGCTGCAGTCGGCCCTGTCG
TCCAACATCTTCCTCATCAGCCAGATGCTCTACTCGCGCTTCTCGGAGAATCTCCTCGTCCGCCTCTTTGGCGTC
TGGGAGGCCAAGGACGGCTCCTCGCAGTTGTACGCCGCCTCGGGCCTCGCCTACTACATGTCGCCCCCGCTCAAC
TTCAAGGATGCCCTGCTGGACCCGATCCATACGGCCGCCTACATCGTCTACATGCTCGGTGCCTGCGCCCTCTTC
TCCAAGACCTGGATCGAGGTCTCCGGCTCCAGCCCCCGCGACGTCGCCAAGCAGCTCAAGGATCAGGGCCTCGTC
ATGGCGGGACATCGCGACCAGAGCATGTACAAGGAGCTCAAGCGCATCATCCCCACCGCCGCCGCCTTTGGAGGC
GCCTGCATCGGAGCCCTTTCCGTCGCCAGCGATCTCATGGGCGCCCTGGGCTCCGGGACCGGGACTCTGCTTGCC
GTCACCATCATCTACGGTTACTTCGAAATCGCTGCCAAGGAGGGAGATTTATCCGGCATGAAGGGCATGATCATG
GGCTAG
Transcript >Ophcf2|03542
ATGAGCTCTTTGCGATTTCTCGACCTGGTGAAGCCATTCGTGCCGTTCCTCCCTGAGGTGCAGCAGCCGGAGACC
AAGATTCCCTTCAACCAGAAGATGATGTGGACGGCTTTGACGCTCCTCATCTTTCTAGTCATGAGTCAGATGCCG
CTGTATGGCATCGTCTCGTCGGATAATTCGGATCCGCTATACTGGCTGCGGATGGTCATCGCCAGTAATCGAGGC
ACGCTCATGGAATTGGGCATCACGCCCATCATCTCTTCTGGCATGGTCTTTCAGCTGCTCGCCGGCACGCACATG
ATCGATGTCAACCTCGACCTCAAGTCGGATCGTGAGCTCTACCAGACGGCTCAGAAGCTCTTTGCCTTTATCCTC
TCGGCCGGCACTGCCACCGTCTACGTCTTCACTGGCCTCTACGGCCCGCCCTCGGATCTTGGCGCCGGCATCGTC
TTCCTTCTCATCTTGCAGCTCGTCGTCGCCGGAATGATTGTCATCCTTCTCGATGAGCTGTTGCAAAAGGGATAC
GGCCTTGGCAGCGGCATCTCCCTCTTCATCGCCACCAACATTTGCGAGTCCATCATGTGGAAGGCCTTTTCGCCC
ACCACCATCAATACCGGCCGCGGCCCCGAGTTCGAAGGCGCCGTCATTGCCCTCTTCCACCTGCTCATGACTTGG
CCCAACAAGCAGCGCGCTCTGCAGGAGGCCTTTTACAGGCAGAACCTCCCCAACATCATGAACCTGCTCGCCACC
ATCCTCGTCTTCGTCGCCGTCATCTACCTGCAGGGCTTCCGCGTCGAGATCCCCGTCAAGTCGTCCCGTCAGCGC
GGCGCTCGTGGCTCTTACCCGGTCCGCCTCTTCTACACGTCCAACATGCCCATCATGCTGCAGTCGGCCCTGTCG
TCCAACATCTTCCTCATCAGCCAGATGCTCTACTCGCGCTTCTCGGAGAATCTCCTCGTCCGCCTCTTTGGCGTC
TGGGAGGCCAAGGACGGCTCCTCGCAGTTGTACGCCGCCTCGGGCCTCGCCTACTACATGTCGCCCCCGCTCAAC
TTCAAGGATGCCCTGCTGGACCCGATCCATACGGCCGCCTACATCGTCTACATGCTCGGTGCCTGCGCCCTCTTC
TCCAAGACCTGGATCGAGGTCTCCGGCTCCAGCCCCCGCGACGTCGCCAAGCAGCTCAAGGATCAGGGCCTCGTC
ATGGCGGGACATCGCGACCAGAGCATGTACAAGGAGCTCAAGCGCATCATCCCCACCGCCGCCGCCTTTGGAGGC
GCCTGCATCGGAGCCCTTTCCGTCGCCAGCGATCTCATGGGCGCCCTGGGCTCCGGGACCGGGACTCTGCTTGCC
GTCACCATCATCTACGGTTACTTCGAAATCGCTGCCAAGGAGGGAGATTTATCCGGCATGAAGGGCATGATCATG
GGCTAG
Gene >Ophcf2|03542
ATGAGCTCTTGTAAGTTGGGCGCTTCGTGATTATCCGGCTGGGACCGGGGAGGGAACTGGTTGCTGACGTTCTTT
GGTGTCGGCAGTGCGATTTCTCGACCTGGTGAAGCCATTCGTGCCGTTCCTCCCTGAGGTGCAGCAGCCGGAGAC
CAAGATTCCCTTCAACCAGAAGATGATGTGGACGGCTTTGACGCTCCTCATCTTTCTAGTCATGAGTCAGATGCC
GCTGTATGGCATCGTCTCGTCGGATAATTCGGATCCGCTATACTGGCTGCGGATGGTCATCGCCAGTAATCGAGG
CACGCTCATGGAATTGGGCATCACGCCCATCATCTCTTCTGGCATGGTCTTTCAGCTGCTCGCCGGCACGCACAT
GATCGATGTCAACCTCGACCTCAAGTCGGATCGTGAGCTCTACCAGACGGCTCAGAAGCTCTTTGCCTTTATCCT
CTCGGCCGGCACTGCCACCGTCTACGTCTTCACTGGCCTCTACGGCCCGCCCTCGGATCTTGGCGCCGGCATCGT
CTTCCTTCTCATCTTGCAGCTCGTCGTCGCCGGAATGATTGTCATCCTTCTCGATGAGCTGTTGCAAAAGGGATA
CGGCCTTGGCAGCGGCATCTCCCTCTTCATCGCCACCAACATTTGCGAGTCCATCATGTGGAAGGCCTTTTCGCC
CACCACCATCAATACCGGCCGCGGCCCCGAGTTCGAAGGCGCCGTCATTGCCCTCTTCCACCTGCTCATGACTTG
GCCCAACAAGCAGCGCGCTCTGCAGGAGGCCTTTTACAGGCAGAACCTCCCCAACATCATGAACCTGCTCGCCAC
CATCCTCGTCTTCGTCGCCGTCATCTACCTGCAGGGCTTCCGCGTCGAGATCCCCGTCAAGTCGTCCCGTCAGCG
CGGCGCTCGTGGCTCTTACCCGGTCCGCCTCTTCTACACGTCCAACATGCCCATCATGCTGCAGTCGGCCCTGTC
GTCCAACATCTTCCTCATCAGCCAGATGCTCTACTCGCGCTTCTCGGAGAATCTCCTCGTCCGCCTCTTTGGCGT
CTGGGAGGCCAAGGACGGCTCCTCGCAGTTGTACGCCGCCTCGGGCCTCGCCTACTACATGTCGCCCCCGCTCAA
CTTCAAGGATGCCCTGCTGGACCCGATCCATACGGCCGCCTACATCGTCTACATGCTCGGTGCCTGCGCCCTCTT
CTCCAAGACCTGGATCGAGGTCTCCGGCTCCAGCCCCCGCGACGTCGCCAAGCAGCTCAAGGATCAGGGCCTCGT
CATGGCGGGACATCGCGACCAGAGCATGTACAAGGAGCTCAAGCGCATCATCCCCACCGCCGCCGCCTTTGGAGG
CGCCTGCATCGGAGCCCTTTCCGTCGCCAGCGATCTCATGGGCGCCCTGGGCTCCGGGACCGGGACTCTGCTTGC
CGTCACGTGAGTATGGTCTCTTTGTCTCTGTTTTATCATGTTGATTCTCTTACTGACTGGGCTTCACGGCAGCAT
CATCTACGGTTACTTCGAAATCGCTGCCAAGGAGGGAGATTTATCCGGCATGAAGGGCATGATCATGGGCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail