Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03537
Gene name
Locationscaffold_03:2983155..2985037
Strand+
Gene length (bp)1882
Transcript length (bp)1605
Coding sequence length (bp)1605
Protein length (aa) 535

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01375 Enterotoxin_a Heat-labile enterotoxin alpha chain 1.3E-05 132 211

GO

GO Term Description Terminal node
GO:0005615 extracellular space Yes
GO:0090729 toxin activity Yes
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0110165 cellular anatomical entity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.2057 0.1168 0.8029 0.1623 0.0941 0.0381 0.271 0.2455 0.2696 0.0032

SignalP

SignalP signal predicted Location Score
Yes 1 - 35 0.999069

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 27.13 14.34 39.93
Alive In ants, during behavior modification 14.11 6.43 21.80
Dead In ants, recently dead 11.50 5.01 17.99

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.001945 yes
Alive Dead 0.350203 no
Dead Fungus 0.000657 yes

Orthologs

Orthofinder run ID4
Orthogroup6887
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|03537 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3638
Ophiocordyceps camponoti-rufipedis Ophun1|5008
Ophiocordyceps kimflemingae Ophio5|8387

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03537
MLRSCHPQPRMMMPRTEMHAAVLLAACLFSWTVAATEDNYSMFTNNTFFENLEPVNLSVYIARPLLGIMEDGTTQ
NSPAYFRRRGGIGEASVDGTLNNHHTNASWGYLSSFFHGQGPWIHLDRSLSNTVHGLYAGREGYIVFDVVASPNM
ITVEADQMLLAGADPSLVHTTVAALGGVQWTQIRRWTYLSYDQWQYPESFEWQTNREYNRSWERLGPSGPQPALR
GPQLSLRGPPPRGQPVEELSVPYEQRARSFMDFLTRFEDELRLMFVRLVDWDYTAEPRDFPLLRLGFGEDEHPPP
TAALPTPEATTSRVESLQNTVLRQLDWENLDGPISAKGPSAQPETTTPTSVAPPSPKATTPPPGNHPVKRDEACH
ELYTIFEPRCDSISALHVDFSIGKAWTWGAGTNDAIGLLFGGARSTHPVTPLLKAPSGGDKVENLPVNLKSVFGS
DIVPLRNITSIQLLDTPLESFWGPDWWKFGGITLTASCASNAQKLQLVDFNQVNEAIRNRVPVPYGPQVVWSRNI
NVTQWRLKR*
Coding >Ophcf2|03537
ATGTTACGCTCCTGCCATCCGCAGCCGAGGATGATGATGCCGCGGACCGAGATGCATGCCGCCGTGCTGCTGGCC
GCGTGCCTATTCTCATGGACCGTCGCCGCCACAGAGGACAATTACTCCATGTTCACTAACAATACTTTCTTTGAG
AATTTGGAACCTGTAAACCTGAGCGTCTACATCGCCCGGCCCTTGCTCGGCATCATGGAGGATGGCACGACGCAG
AATTCGCCAGCGTACTTCAGGCGACGGGGCGGGATAGGCGAAGCCTCGGTCGACGGCACGCTGAATAACCATCAC
ACCAACGCATCATGGGGTTACCTTTCAAGCTTCTTCCACGGCCAGGGCCCCTGGATCCATCTCGACCGCTCTCTC
TCCAACACCGTCCATGGTCTCTACGCGGGTCGTGAAGGGTACATCGTCTTCGACGTCGTCGCATCGCCCAACATG
ATCACCGTGGAAGCCGACCAGATGCTCCTCGCGGGAGCCGACCCAAGCCTGGTCCACACCACGGTCGCCGCGCTG
GGGGGCGTACAATGGACACAGATCCGGCGATGGACCTACCTAAGCTACGACCAGTGGCAATATCCCGAATCATTC
GAGTGGCAGACGAACCGCGAATACAACCGCTCATGGGAGAGGCTGGGGCCGAGCGGTCCACAGCCAGCGCTCAGG
GGTCCACAGCTATCGCTCAGAGGTCCCCCTCCACGAGGGCAACCGGTGGAAGAGCTATCGGTTCCGTATGAGCAG
CGTGCTCGTTCCTTCATGGATTTCCTTACACGGTTTGAAGATGAGCTGCGACTCATGTTCGTACGACTGGTCGAT
TGGGACTACACAGCCGAACCGCGAGACTTCCCCCTCCTCCGCTTAGGATTCGGCGAAGACGAACATCCACCACCG
ACAGCAGCTCTCCCCACCCCCGAAGCCACCACCTCAAGAGTCGAATCCCTTCAAAACACGGTCCTCCGCCAACTG
GACTGGGAAAACCTCGACGGCCCCATCTCTGCGAAGGGGCCCTCCGCTCAGCCCGAAACTACTACGCCCACCAGC
GTCGCGCCACCCTCCCCCAAGGCGACGACGCCCCCCCCCGGGAACCACCCCGTCAAGCGCGACGAAGCCTGCCAT
GAGCTCTACACCATCTTCGAGCCCAGATGCGATTCCATCTCCGCTCTACACGTCGACTTCTCCATAGGCAAAGCC
TGGACCTGGGGCGCGGGCACCAACGATGCCATAGGCTTGCTCTTCGGCGGCGCCCGCAGCACACACCCCGTCACC
CCCCTCCTCAAAGCCCCATCAGGAGGCGACAAAGTCGAGAACCTACCCGTCAATCTCAAATCCGTCTTCGGCTCC
GACATCGTACCGCTGCGCAACATAACCTCGATACAACTCCTCGACACCCCTCTGGAAAGCTTCTGGGGTCCCGAC
TGGTGGAAGTTTGGCGGAATCACCCTGACAGCAAGCTGCGCCAGCAATGCCCAGAAACTCCAACTGGTCGATTTC
AACCAAGTCAACGAGGCCATTCGGAACAGGGTCCCGGTGCCGTACGGACCGCAGGTTGTGTGGTCTCGCAACATC
AACGTTACGCAGTGGCGGCTGAAACGGTGA
Transcript >Ophcf2|03537
ATGTTACGCTCCTGCCATCCGCAGCCGAGGATGATGATGCCGCGGACCGAGATGCATGCCGCCGTGCTGCTGGCC
GCGTGCCTATTCTCATGGACCGTCGCCGCCACAGAGGACAATTACTCCATGTTCACTAACAATACTTTCTTTGAG
AATTTGGAACCTGTAAACCTGAGCGTCTACATCGCCCGGCCCTTGCTCGGCATCATGGAGGATGGCACGACGCAG
AATTCGCCAGCGTACTTCAGGCGACGGGGCGGGATAGGCGAAGCCTCGGTCGACGGCACGCTGAATAACCATCAC
ACCAACGCATCATGGGGTTACCTTTCAAGCTTCTTCCACGGCCAGGGCCCCTGGATCCATCTCGACCGCTCTCTC
TCCAACACCGTCCATGGTCTCTACGCGGGTCGTGAAGGGTACATCGTCTTCGACGTCGTCGCATCGCCCAACATG
ATCACCGTGGAAGCCGACCAGATGCTCCTCGCGGGAGCCGACCCAAGCCTGGTCCACACCACGGTCGCCGCGCTG
GGGGGCGTACAATGGACACAGATCCGGCGATGGACCTACCTAAGCTACGACCAGTGGCAATATCCCGAATCATTC
GAGTGGCAGACGAACCGCGAATACAACCGCTCATGGGAGAGGCTGGGGCCGAGCGGTCCACAGCCAGCGCTCAGG
GGTCCACAGCTATCGCTCAGAGGTCCCCCTCCACGAGGGCAACCGGTGGAAGAGCTATCGGTTCCGTATGAGCAG
CGTGCTCGTTCCTTCATGGATTTCCTTACACGGTTTGAAGATGAGCTGCGACTCATGTTCGTACGACTGGTCGAT
TGGGACTACACAGCCGAACCGCGAGACTTCCCCCTCCTCCGCTTAGGATTCGGCGAAGACGAACATCCACCACCG
ACAGCAGCTCTCCCCACCCCCGAAGCCACCACCTCAAGAGTCGAATCCCTTCAAAACACGGTCCTCCGCCAACTG
GACTGGGAAAACCTCGACGGCCCCATCTCTGCGAAGGGGCCCTCCGCTCAGCCCGAAACTACTACGCCCACCAGC
GTCGCGCCACCCTCCCCCAAGGCGACGACGCCCCCCCCCGGGAACCACCCCGTCAAGCGCGACGAAGCCTGCCAT
GAGCTCTACACCATCTTCGAGCCCAGATGCGATTCCATCTCCGCTCTACACGTCGACTTCTCCATAGGCAAAGCC
TGGACCTGGGGCGCGGGCACCAACGATGCCATAGGCTTGCTCTTCGGCGGCGCCCGCAGCACACACCCCGTCACC
CCCCTCCTCAAAGCCCCATCAGGAGGCGACAAAGTCGAGAACCTACCCGTCAATCTCAAATCCGTCTTCGGCTCC
GACATCGTACCGCTGCGCAACATAACCTCGATACAACTCCTCGACACCCCTCTGGAAAGCTTCTGGGGTCCCGAC
TGGTGGAAGTTTGGCGGAATCACCCTGACAGCAAGCTGCGCCAGCAATGCCCAGAAACTCCAACTGGTCGATTTC
AACCAAGTCAACGAGGCCATTCGGAACAGGGTCCCGGTGCCGTACGGACCGCAGGTTGTGTGGTCTCGCAACATC
AACGTTACGCAGTGGCGGCTGAAACGGTGA
Gene >Ophcf2|03537
ATGTTACGCTCCTGGTCCTTGCCAACACGAAGTCGAGACATTTGCCAAGCTTCCATCATGTTATACGCCTTTTCG
AGTCATGGGACTGGCTTCTTCACCATTCTCACCTCGTACTCATCAAGGCCCGTGGTATAAAGCCATCCGGTGAGG
ACCTCTCCTCCGACTCGGCAAACTCCACACTGACAATTCCACAGCAGCCGAGGATGATGATGCCGCGGACCGAGA
TGCATGCCGCCGTGCTGCTGGCCGCGTGCCTATTCTCATGGACCGTCGCCGCCACAGAGGACAATTACTCCATGT
TCACTAACAATACTTTCTTTGAGAATTTGGAACCTGTAAACCTGAGCGTCTACATCGCCCGGCCCTTGCTCGGCA
TCATGGAGGATGGCACGACGCAGAATTCGCCAGCGTACTTCAGGCGACGGGGCGGGATAGGCGAAGCCTCGGTCG
ACGGCACGCTGAATAACCATCACACCAACGCATCATGGGGTTACCTTTCAAGCTTCTTCCACGGCCAGGGCCCCT
GGATCCATCTCGACCGCTCTCTCTCCAACACCGTCCATGGTCTCTACGCGGGTCGTGAAGGGTACATCGTCTTCG
ACGTCGTCGCATCGCCCAACATGATCACCGTGGAAGCCGACCAGATGCTCCTCGCGGGAGCCGACCCAAGCCTGG
TCCACACCACGGTCGCCGCGCTGGGGGGCGTACAATGGACACAGATCCGGCGATGGACCTACCTAAGCTACGACC
AGTGGCAATATCCCGAATCATTCGAGTGGCAGACGAACCGCGAATACAACCGCTCATGGGAGAGGCTGGGGCCGA
GCGGTCCACAGCCAGCGCTCAGGGGTCCACAGCTATCGCTCAGAGGTCCCCCTCCACGAGGGCAACCGGTGGAAG
AGCTATCGGTTCCGTATGAGCAGCGTGCTCGTTCCTTCATGGATTTCCTTACACGGTTTGAAGATGAGCTGCGAC
TCATGTTCGTACGACTGGTCGATTGGGACTACACAGCCGAACCGCGAGACTTCCCCCTCCTCCGCTTAGGATTCG
GCGAAGACGAACATCCACCACCGACAGCAGCTCTCCCCACCCCCGAAGCCACCACCTCAAGAGTCGAATCCCTTC
AAAACACGGTCCTCCGCCAACTGGACTGGGAAAACCTCGACGGCCCCATGTTCATCCGCCAGGCCATGCTCGCAG
GCGCAGCTCTAACCCCCCAGCTCTGCGAAGGGGCCCTCCGCTCAGCCCGAAACTACTACGCCCACCAGCGTCGCG
CCACCCTCCCCCAAGGCGACGACGCCCCCCCCCGGGAACCACCCCGTCAAGCGCGACGAAGCCTGCCATGAGCTC
TACACCATCTTCGAGCCCAGATGCGATTCCATCTCCGCTCTACACGTCGACTTCTCCATAGGCAAAGCCTGGACC
TGGGGCGCGGGCACCAACGATGCCATAGGCTTGCTCTTCGGCGGCGCCCGCAGCACACACCCCGTCACCCCCCTC
CTCAAAGCCCCATCAGGAGGCGACAAAGTCGAGAACCTACCCGTCAATCTCAAATCCGTCTTCGGCTCCGACATC
GTACCGCTGCGCAACATAACCTCGATACAACTCCTCGACACCCCTCTGGAAAGCTTCTGGGGTCCCGACTGGTGG
AAGTTTGGCGGTGATTTCTTCCCTTGCCCCCCTTTTCCGCTTTCCCCCCAAAGCTAACGAGATGAAAGGAATCAC
CCTGACAGCAAGCTGCGCCAGCAATGCCCAGAAACTCCAACTGGTCGATTTCAACCAAGTCAACGAGGCCATTCG
GAACAGGGTCCCGGTGCCGTACGGACCGCAGGTTGTGTGGTCTCGCAACATCAACGTTACGCAGTGGCGGCTGAA
ACGGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail