Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03536
Gene name
Locationscaffold_03:2981252..2982491
Strand-
Gene length (bp)1239
Transcript length (bp)1239
Coding sequence length (bp)1239
Protein length (aa) 413

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 60 0.45

Transmembrane Domains

Domain # Start End Length
1 292 314 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 32.16 16.53 47.79
Alive In ants, during behavior modification 41.87 22.60 61.13
Dead In ants, recently dead 33.11 17.11 49.10

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.223332 no
Alive Dead 0.200183 no
Dead Fungus 0.917828 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03536
MGKPSLPGSDPAPPSARFNEPGSAISLHGPSSAPYRDDPAAIDDDDDDDDDDDDDDELPPLYSEHDEYHDQGPLV
DPLVPPGTGPLVSPFGHDSEGAVAYYMDGRLDSDPVFLADHIRRLAVVPPRPSVRLRGTHRQRRRRAGDNSHVTG
GDDVVVDFDIRIELTHLLYSDIRRQQAWRALVTAGNFEKVRRGTIFPDRAPGFGGSPGGDVERDGVPGLEQWCHR
FCASPARLRCFSLQRRIVGWDWELLRRRLEGLVRATNYRGHAVVSFPIGNAQADIYSDCRPNRWRLTGWIRFIFY
ASLLFLVTWPWLFLRTRRWETVAAEWYVSMPTSVPGRRQYAAGVSEERWYALWAPAIQRAMLDRRDGLLDQGDLE
RARSEVAGGWLARASGRLWGLLIGHSDGGGMRFRGLD*
Coding >Ophcf2|03536
ATGGGTAAACCATCCCTCCCCGGATCCGATCCGGCTCCACCCTCTGCCCGCTTCAACGAGCCCGGAAGCGCCATC
TCCCTGCACGGACCGTCATCGGCCCCCTACCGCGACGATCCAGCCGCCATCGACGACGACGACGACGACGACGAC
GACGACGACGACGACGACGAACTCCCGCCTCTATACAGCGAACACGATGAATATCATGACCAAGGACCCCTCGTC
GATCCCCTCGTCCCCCCCGGAACCGGCCCACTCGTCTCACCCTTTGGACACGACAGCGAAGGCGCAGTCGCTTAC
TACATGGATGGACGTCTCGACTCCGACCCCGTCTTCCTAGCCGATCACATCCGACGTCTGGCCGTCGTCCCCCCC
CGACCATCAGTCCGACTCCGCGGCACACACCGACAACGACGGCGCCGAGCCGGTGACAACAGCCACGTAACAGGC
GGCGATGACGTCGTGGTAGACTTCGACATCCGCATCGAGCTGACGCACCTCCTCTACTCGGACATCCGTCGCCAG
CAAGCCTGGCGCGCCCTCGTCACAGCCGGCAACTTTGAAAAGGTCCGCCGCGGCACCATCTTCCCCGATCGCGCT
CCTGGCTTCGGCGGCTCTCCCGGCGGAGACGTGGAGCGGGACGGCGTCCCCGGCTTGGAGCAGTGGTGTCATCGG
TTCTGTGCCAGTCCAGCTCGACTGCGATGTTTCAGCCTTCAACGTCGAATCGTAGGCTGGGATTGGGAGCTGTTG
AGACGCAGGCTAGAAGGCCTGGTTCGAGCAACCAACTACCGCGGCCACGCCGTCGTCAGCTTCCCCATCGGCAAC
GCTCAAGCCGACATTTACAGCGACTGCCGGCCCAACCGATGGCGTCTCACAGGCTGGATCCGCTTCATCTTCTAC
GCCAGCCTGCTCTTCCTCGTCACCTGGCCGTGGCTCTTCCTCCGGACGCGCCGGTGGGAGACGGTCGCGGCAGAG
TGGTACGTCAGCATGCCGACGAGCGTGCCGGGTCGACGGCAGTACGCGGCCGGGGTGAGCGAGGAGCGGTGGTAC
GCGCTGTGGGCGCCCGCCATTCAGCGCGCCATGCTGGATCGCAGGGATGGTCTGCTGGACCAGGGGGACCTGGAG
AGGGCGAGGAGTGAGGTTGCCGGGGGGTGGTTGGCGCGGGCGTCGGGGCGGCTATGGGGGTTGTTGATCGGTCAT
TCGGATGGGGGGGGGATGAGGTTCAGGGGTTTGGACTGA
Transcript >Ophcf2|03536
ATGGGTAAACCATCCCTCCCCGGATCCGATCCGGCTCCACCCTCTGCCCGCTTCAACGAGCCCGGAAGCGCCATC
TCCCTGCACGGACCGTCATCGGCCCCCTACCGCGACGATCCAGCCGCCATCGACGACGACGACGACGACGACGAC
GACGACGACGACGACGACGAACTCCCGCCTCTATACAGCGAACACGATGAATATCATGACCAAGGACCCCTCGTC
GATCCCCTCGTCCCCCCCGGAACCGGCCCACTCGTCTCACCCTTTGGACACGACAGCGAAGGCGCAGTCGCTTAC
TACATGGATGGACGTCTCGACTCCGACCCCGTCTTCCTAGCCGATCACATCCGACGTCTGGCCGTCGTCCCCCCC
CGACCATCAGTCCGACTCCGCGGCACACACCGACAACGACGGCGCCGAGCCGGTGACAACAGCCACGTAACAGGC
GGCGATGACGTCGTGGTAGACTTCGACATCCGCATCGAGCTGACGCACCTCCTCTACTCGGACATCCGTCGCCAG
CAAGCCTGGCGCGCCCTCGTCACAGCCGGCAACTTTGAAAAGGTCCGCCGCGGCACCATCTTCCCCGATCGCGCT
CCTGGCTTCGGCGGCTCTCCCGGCGGAGACGTGGAGCGGGACGGCGTCCCCGGCTTGGAGCAGTGGTGTCATCGG
TTCTGTGCCAGTCCAGCTCGACTGCGATGTTTCAGCCTTCAACGTCGAATCGTAGGCTGGGATTGGGAGCTGTTG
AGACGCAGGCTAGAAGGCCTGGTTCGAGCAACCAACTACCGCGGCCACGCCGTCGTCAGCTTCCCCATCGGCAAC
GCTCAAGCCGACATTTACAGCGACTGCCGGCCCAACCGATGGCGTCTCACAGGCTGGATCCGCTTCATCTTCTAC
GCCAGCCTGCTCTTCCTCGTCACCTGGCCGTGGCTCTTCCTCCGGACGCGCCGGTGGGAGACGGTCGCGGCAGAG
TGGTACGTCAGCATGCCGACGAGCGTGCCGGGTCGACGGCAGTACGCGGCCGGGGTGAGCGAGGAGCGGTGGTAC
GCGCTGTGGGCGCCCGCCATTCAGCGCGCCATGCTGGATCGCAGGGATGGTCTGCTGGACCAGGGGGACCTGGAG
AGGGCGAGGAGTGAGGTTGCCGGGGGGTGGTTGGCGCGGGCGTCGGGGCGGCTATGGGGGTTGTTGATCGGTCAT
TCGGATGGGGGGGGGATGAGGTTCAGGGGTTTGGACTGA
Gene >Ophcf2|03536
ATGGGTAAACCATCCCTCCCCGGATCCGATCCGGCTCCACCCTCTGCCCGCTTCAACGAGCCCGGAAGCGCCATC
TCCCTGCACGGACCGTCATCGGCCCCCTACCGCGACGATCCAGCCGCCATCGACGACGACGACGACGACGACGAC
GACGACGACGACGACGACGAACTCCCGCCTCTATACAGCGAACACGATGAATATCATGACCAAGGACCCCTCGTC
GATCCCCTCGTCCCCCCCGGAACCGGCCCACTCGTCTCACCCTTTGGACACGACAGCGAAGGCGCAGTCGCTTAC
TACATGGATGGACGTCTCGACTCCGACCCCGTCTTCCTAGCCGATCACATCCGACGTCTGGCCGTCGTCCCCCCC
CGACCATCAGTCCGACTCCGCGGCACACACCGACAACGACGGCGCCGAGCCGGTGACAACAGCCACGTAACAGGC
GGCGATGACGTCGTGGTAGACTTCGACATCCGCATCGAGCTGACGCACCTCCTCTACTCGGACATCCGTCGCCAG
CAAGCCTGGCGCGCCCTCGTCACAGCCGGCAACTTTGAAAAGGTCCGCCGCGGCACCATCTTCCCCGATCGCGCT
CCTGGCTTCGGCGGCTCTCCCGGCGGAGACGTGGAGCGGGACGGCGTCCCCGGCTTGGAGCAGTGGTGTCATCGG
TTCTGTGCCAGTCCAGCTCGACTGCGATGTTTCAGCCTTCAACGTCGAATCGTAGGCTGGGATTGGGAGCTGTTG
AGACGCAGGCTAGAAGGCCTGGTTCGAGCAACCAACTACCGCGGCCACGCCGTCGTCAGCTTCCCCATCGGCAAC
GCTCAAGCCGACATTTACAGCGACTGCCGGCCCAACCGATGGCGTCTCACAGGCTGGATCCGCTTCATCTTCTAC
GCCAGCCTGCTCTTCCTCGTCACCTGGCCGTGGCTCTTCCTCCGGACGCGCCGGTGGGAGACGGTCGCGGCAGAG
TGGTACGTCAGCATGCCGACGAGCGTGCCGGGTCGACGGCAGTACGCGGCCGGGGTGAGCGAGGAGCGGTGGTAC
GCGCTGTGGGCGCCCGCCATTCAGCGCGCCATGCTGGATCGCAGGGATGGTCTGCTGGACCAGGGGGACCTGGAG
AGGGCGAGGAGTGAGGTTGCCGGGGGGTGGTTGGCGCGGGCGTCGGGGCGGCTATGGGGGTTGTTGATCGGTCAT
TCGGATGGGGGGGGGATGAGGTTCAGGGGTTTGGACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail