Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03535
Gene name
Locationscaffold_03:2976165..2979963
Strand+
Gene length (bp)3798
Transcript length (bp)3687
Coding sequence length (bp)3687
Protein length (aa) 1229

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16212 PhoLip_ATPase_C Phospholipid-translocating P-type ATPase C-terminal 1.8E-56 936 1187
PF00702 Hydrolase haloacid dehalogenase-like hydrolase 8.1E-08 447 811
PF13246 Cation_ATPase Cation transport ATPase (P-type) 2.4E-09 518 616
PF16209 PhoLip_ATPase_N Phospholipid-translocating ATPase N-terminal 2.4E-09 83 129
PF00122 E1-E2_ATPase E1-E2 ATPase 2.7E-07 179 404

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 58 0.5

Transmembrane Domains

Domain # Start End Length
1 343 365 22
2 386 408 22
3 984 1006 22
4 1050 1072 22
5 1087 1106 19
6 1113 1135 22
7 1155 1177 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03535
MLDRERGLPRPVQVAPSKVESIFSTLGSEYVTLFPWPMRLRLYVRLVACHLLGLKWALPQQKGRRIPLLAGNENL
LDVRTGLPYMGNRIRTNRYTLISFLPKQLWLQTTRPHVIWFWLLFIVQLKLPAMAAGIWNTLGPLLAYTCFYMLC
DMWRDYRRYQLDREENGSRAFVLVRGRHGEKKTKTDWLVVKWKKIRVGDVVRLLRNEAAPADLILLHASGPDGVA
YIDTMALDGETNLKSKQVPQPLAERCATVAGIRTADAVFTSEDPNSDLYRYEGMATVGGRILPLSQSNVVYRGST
LRNTDEAVGLVINSGEECKIRVSARDHIRNKVSALNVAANKKMVFQISIALVLLAVLICFNLEWRHRFACKARTL
VGGSNSLKNTTLSHIFMLSELIPLSLFVAIQFIRWGQLFFMHDVEMYDPATDTPMKVNTDSILEDLGQVTHVFSD
KTGTMTENSMHFRKMTVGGAACLHLPDGGAEDEEVPEIKTEVLMDYVGRHPDTAFSRRTRHLLLCMALCHTCLLE
TTPQRRIKFLATSPDELALVEAARDLGLVLTNRSGGGMSIRRSDDGSVEKYQVLDVIEFSSARKRMSIVVRMPDG
RIHVICKGADAVMTERLALREAAEEKTKQIGQRNNQRKTIELERERRMMRTSDMDRDRERSRRRTFELSWSRRGT
RERSRERRKTFELGRISSRVAEKRRRLTDADETLAADDEAVLSRCLEHVDDFSTEGLRTLMYASRVTSPVERQKR
VEEVGGLLETDLDLAGATAIEDKLQKGVAETVDQLRRAGIKVWMLTGDKRETAINIGHAAGLCKPSSDVLLLDGP
ASVAAALRDARPGPPSAPTVAVLDGRMLSALQTAAHDDFIASQFGELICRVDSVIFCRATPPQKAALVEVVRKQQ
PKSLTLAMGDGANDVGMLETAHVGVGISGREGLQAARVSDYSIGQFRFLARLLLVHGRWNYMRTARFILETYWKG
AFFVMMQMWFQIFCAGATTTSLFENYSLMFFSLFMSGPALIIPAVLDQDLSARTLLAKPELYRSGPSCRAFNRYL
YMGWTVMGWLSSVVLFGIMWGGFRGVLIDDDGSFFAFGHAQFVVVVIYLNLKLLVLECYRITIVNLYCFIVAVST
LLIVTAATTQGSEHKLEAFHMRGSGEHVFGRLRWWATILCGLVAVVMVDLAVQVLRRVLFPSDLDEEMRIEREEF
GGEKRDELGEREKGLGIGGGFGVVFGRD*
Coding >Ophcf2|03535
ATGCTCGACCGTGAGCGCGGTTTGCCTCGTCCAGTTCAAGTGGCCCCCTCCAAGGTGGAGAGTATCTTTTCGACT
CTGGGCTCGGAATATGTTACCTTATTCCCCTGGCCGATGCGTCTGCGGCTTTACGTCCGACTCGTCGCCTGCCAT
CTTTTGGGCTTGAAGTGGGCGCTGCCGCAGCAAAAGGGGCGGCGGATTCCGCTTCTGGCCGGTAACGAGAACTTG
TTGGACGTGCGGACTGGCCTCCCCTACATGGGCAACCGCATTCGCACCAACCGGTATACGCTCATCAGCTTCCTG
CCCAAGCAGCTGTGGTTGCAGACGACGAGACCCCATGTCATTTGGTTCTGGTTATTATTTATTGTACAGTTGAAA
TTGCCTGCCATGGCTGCTGGCATCTGGAACACCCTCGGGCCGCTGCTGGCTTACACCTGTTTCTACATGTTGTGT
GACATGTGGCGGGATTACCGTCGGTATCAACTTGACAGAGAGGAGAATGGCAGTCGTGCCTTTGTGCTGGTCCGG
GGACGTCACGGCGAGAAAAAGACGAAGACAGACTGGCTGGTCGTCAAGTGGAAGAAGATTCGTGTCGGTGACGTG
GTCCGGCTGCTGCGAAACGAGGCCGCTCCGGCGGATCTGATCCTGCTGCACGCCTCTGGACCCGACGGCGTGGCG
TACATCGACACCATGGCTCTCGACGGTGAGACCAACCTCAAGTCCAAACAGGTTCCTCAGCCGCTGGCAGAACGT
TGTGCCACGGTGGCCGGCATCCGGACCGCCGACGCAGTCTTTACGTCCGAGGACCCGAATTCTGACCTGTACAGA
TACGAGGGCATGGCGACTGTCGGCGGCAGGATACTGCCCCTGTCGCAGTCCAACGTCGTCTATCGCGGCTCGACG
CTGCGCAACACAGACGAAGCCGTCGGGCTGGTCATCAACTCTGGCGAGGAATGCAAGATTCGTGTCAGCGCACGG
GACCATATCCGCAACAAGGTGTCTGCCTTGAACGTCGCCGCCAACAAGAAGATGGTATTTCAGATAAGCATCGCA
CTCGTCTTGTTAGCCGTCCTGATATGCTTCAATCTGGAGTGGCGGCACAGGTTCGCGTGCAAGGCGAGGACCTTG
GTAGGTGGAAGTAACTCGCTCAAGAACACTACCTTGAGCCACATCTTTATGCTATCGGAGCTGATTCCGCTGTCA
CTTTTCGTTGCCATCCAGTTCATCAGATGGGGGCAACTGTTCTTCATGCACGACGTGGAAATGTACGACCCGGCG
ACGGACACGCCCATGAAAGTCAACACGGACTCCATCCTCGAGGACCTGGGACAGGTGACGCATGTCTTTTCCGAC
AAGACGGGGACCATGACGGAGAACTCGATGCACTTTCGCAAGATGACGGTCGGCGGCGCGGCTTGTCTTCATCTG
CCCGACGGGGGGGCCGAAGACGAGGAGGTTCCAGAGATTAAGACGGAGGTTCTGATGGACTACGTCGGCCGCCAT
CCGGACACGGCATTCTCCCGCAGGACGAGACATCTGCTGCTGTGCATGGCGCTGTGTCACACGTGCCTATTGGAG
ACGACGCCCCAAAGACGGATCAAGTTCCTGGCCACGTCCCCGGACGAGCTGGCCCTGGTTGAGGCGGCTCGCGAT
CTGGGACTGGTGCTGACGAACCGGTCGGGGGGGGGGATGTCGATTCGGAGGAGCGACGACGGCAGTGTCGAGAAA
TACCAAGTGTTGGATGTCATCGAGTTCAGCAGCGCGCGCAAGAGGATGTCGATCGTGGTGCGGATGCCGGACGGG
AGAATCCACGTCATCTGCAAGGGCGCTGATGCCGTCATGACGGAAAGACTGGCGCTGAGAGAGGCAGCTGAAGAA
AAGACCAAGCAGATCGGGCAGCGCAACAACCAGCGGAAGACTATCGAGCTTGAGCGCGAGAGGCGGATGATGAGG
ACGTCAGACATGGATCGGGACCGGGAGAGGAGCCGCAGGAGAACATTTGAGCTGAGCTGGTCCCGGCGAGGGACG
CGGGAGCGGAGCCGGGAGAGGCGCAAGACGTTTGAGCTGGGCCGGATAAGCAGCAGGGTAGCGGAGAAGCGACGA
CGACTGACGGATGCCGACGAGACGCTGGCGGCTGACGACGAGGCTGTCCTGAGCCGCTGCCTGGAGCACGTCGAC
GACTTCTCGACCGAGGGCCTACGCACGCTCATGTACGCCTCTCGAGTCACGAGCCCCGTCGAGCGCCAGAAACGG
GTGGAGGAAGTGGGCGGTCTGCTCGAGACGGACCTGGACTTGGCGGGCGCGACGGCCATCGAGGACAAGCTACAG
AAGGGGGTGGCAGAGACGGTGGACCAGCTGCGGCGGGCCGGTATCAAGGTGTGGATGCTGACGGGCGACAAGCGA
GAGACGGCCATCAACATCGGGCACGCGGCCGGTCTTTGCAAGCCGTCTTCGGATGTGCTGTTGCTCGACGGGCCG
GCTTCGGTGGCGGCCGCTCTCCGGGATGCCCGGCCCGGCCCACCCTCGGCGCCGACGGTGGCGGTTCTCGACGGG
CGGATGCTGTCGGCGCTCCAGACGGCAGCCCACGACGACTTCATTGCGAGCCAGTTCGGCGAGCTCATCTGTCGG
GTCGACTCGGTCATCTTCTGTCGGGCCACTCCTCCGCAAAAGGCGGCCCTCGTCGAGGTGGTCCGCAAGCAGCAG
CCCAAGAGCCTGACACTCGCCATGGGAGACGGCGCCAACGACGTGGGCATGCTGGAGACGGCTCACGTCGGCGTC
GGGATCTCGGGTCGCGAGGGACTGCAGGCCGCTCGCGTGTCCGACTATTCCATCGGCCAGTTCCGCTTCCTGGCG
CGGCTGCTGCTCGTTCACGGTCGATGGAACTACATGCGGACGGCGCGATTCATCCTGGAAACGTACTGGAAGGGG
GCCTTCTTCGTCATGATGCAGATGTGGTTCCAGATCTTCTGCGCGGGCGCCACGACCACGTCACTGTTTGAGAAC
TACAGCTTGATGTTCTTCAGCTTATTCATGTCGGGGCCGGCCCTCATCATCCCGGCTGTGCTGGATCAAGACCTA
TCGGCCCGGACTCTCCTGGCCAAGCCGGAGCTGTACAGGTCGGGTCCCTCGTGCCGGGCCTTCAACAGATATTTG
TACATGGGCTGGACGGTCATGGGGTGGCTGAGCAGCGTCGTGCTGTTTGGCATCATGTGGGGGGGGTTCCGGGGG
GTTTTGATCGATGACGATGGGTCCTTTTTCGCCTTTGGACATGCGCAGTTCGTCGTCGTCGTCATTTATTTGAAC
CTGAAGCTGCTCGTCTTGGAATGCTATAGAATCACCATCGTCAACCTCTACTGCTTCATCGTGGCCGTGAGCACC
CTCTTGATTGTGACGGCTGCGACTACGCAAGGATCGGAGCACAAGCTTGAGGCCTTTCACATGCGGGGGTCGGGG
GAGCACGTCTTTGGCCGGCTGCGGTGGTGGGCGACGATTCTGTGCGGGTTGGTGGCGGTGGTGATGGTGGACCTG
GCGGTGCAGGTGCTGCGGCGCGTCTTGTTCCCTTCGGATCTGGATGAGGAGATGAGGATTGAGAGGGAGGAGTTT
GGGGGGGAGAAGAGGGATGAGTTGGGGGAGAGGGAGAAGGGGTTAGGGATTGGGGGGGGTTTTGGGGTTGTTTTT
GGACGGGATTAA
Transcript >Ophcf2|03535
ATGCTCGACCGTGAGCGCGGTTTGCCTCGTCCAGTTCAAGTGGCCCCCTCCAAGGTGGAGAGTATCTTTTCGACT
CTGGGCTCGGAATATGTTACCTTATTCCCCTGGCCGATGCGTCTGCGGCTTTACGTCCGACTCGTCGCCTGCCAT
CTTTTGGGCTTGAAGTGGGCGCTGCCGCAGCAAAAGGGGCGGCGGATTCCGCTTCTGGCCGGTAACGAGAACTTG
TTGGACGTGCGGACTGGCCTCCCCTACATGGGCAACCGCATTCGCACCAACCGGTATACGCTCATCAGCTTCCTG
CCCAAGCAGCTGTGGTTGCAGACGACGAGACCCCATGTCATTTGGTTCTGGTTATTATTTATTGTACAGTTGAAA
TTGCCTGCCATGGCTGCTGGCATCTGGAACACCCTCGGGCCGCTGCTGGCTTACACCTGTTTCTACATGTTGTGT
GACATGTGGCGGGATTACCGTCGGTATCAACTTGACAGAGAGGAGAATGGCAGTCGTGCCTTTGTGCTGGTCCGG
GGACGTCACGGCGAGAAAAAGACGAAGACAGACTGGCTGGTCGTCAAGTGGAAGAAGATTCGTGTCGGTGACGTG
GTCCGGCTGCTGCGAAACGAGGCCGCTCCGGCGGATCTGATCCTGCTGCACGCCTCTGGACCCGACGGCGTGGCG
TACATCGACACCATGGCTCTCGACGGTGAGACCAACCTCAAGTCCAAACAGGTTCCTCAGCCGCTGGCAGAACGT
TGTGCCACGGTGGCCGGCATCCGGACCGCCGACGCAGTCTTTACGTCCGAGGACCCGAATTCTGACCTGTACAGA
TACGAGGGCATGGCGACTGTCGGCGGCAGGATACTGCCCCTGTCGCAGTCCAACGTCGTCTATCGCGGCTCGACG
CTGCGCAACACAGACGAAGCCGTCGGGCTGGTCATCAACTCTGGCGAGGAATGCAAGATTCGTGTCAGCGCACGG
GACCATATCCGCAACAAGGTGTCTGCCTTGAACGTCGCCGCCAACAAGAAGATGGTATTTCAGATAAGCATCGCA
CTCGTCTTGTTAGCCGTCCTGATATGCTTCAATCTGGAGTGGCGGCACAGGTTCGCGTGCAAGGCGAGGACCTTG
GTAGGTGGAAGTAACTCGCTCAAGAACACTACCTTGAGCCACATCTTTATGCTATCGGAGCTGATTCCGCTGTCA
CTTTTCGTTGCCATCCAGTTCATCAGATGGGGGCAACTGTTCTTCATGCACGACGTGGAAATGTACGACCCGGCG
ACGGACACGCCCATGAAAGTCAACACGGACTCCATCCTCGAGGACCTGGGACAGGTGACGCATGTCTTTTCCGAC
AAGACGGGGACCATGACGGAGAACTCGATGCACTTTCGCAAGATGACGGTCGGCGGCGCGGCTTGTCTTCATCTG
CCCGACGGGGGGGCCGAAGACGAGGAGGTTCCAGAGATTAAGACGGAGGTTCTGATGGACTACGTCGGCCGCCAT
CCGGACACGGCATTCTCCCGCAGGACGAGACATCTGCTGCTGTGCATGGCGCTGTGTCACACGTGCCTATTGGAG
ACGACGCCCCAAAGACGGATCAAGTTCCTGGCCACGTCCCCGGACGAGCTGGCCCTGGTTGAGGCGGCTCGCGAT
CTGGGACTGGTGCTGACGAACCGGTCGGGGGGGGGGATGTCGATTCGGAGGAGCGACGACGGCAGTGTCGAGAAA
TACCAAGTGTTGGATGTCATCGAGTTCAGCAGCGCGCGCAAGAGGATGTCGATCGTGGTGCGGATGCCGGACGGG
AGAATCCACGTCATCTGCAAGGGCGCTGATGCCGTCATGACGGAAAGACTGGCGCTGAGAGAGGCAGCTGAAGAA
AAGACCAAGCAGATCGGGCAGCGCAACAACCAGCGGAAGACTATCGAGCTTGAGCGCGAGAGGCGGATGATGAGG
ACGTCAGACATGGATCGGGACCGGGAGAGGAGCCGCAGGAGAACATTTGAGCTGAGCTGGTCCCGGCGAGGGACG
CGGGAGCGGAGCCGGGAGAGGCGCAAGACGTTTGAGCTGGGCCGGATAAGCAGCAGGGTAGCGGAGAAGCGACGA
CGACTGACGGATGCCGACGAGACGCTGGCGGCTGACGACGAGGCTGTCCTGAGCCGCTGCCTGGAGCACGTCGAC
GACTTCTCGACCGAGGGCCTACGCACGCTCATGTACGCCTCTCGAGTCACGAGCCCCGTCGAGCGCCAGAAACGG
GTGGAGGAAGTGGGCGGTCTGCTCGAGACGGACCTGGACTTGGCGGGCGCGACGGCCATCGAGGACAAGCTACAG
AAGGGGGTGGCAGAGACGGTGGACCAGCTGCGGCGGGCCGGTATCAAGGTGTGGATGCTGACGGGCGACAAGCGA
GAGACGGCCATCAACATCGGGCACGCGGCCGGTCTTTGCAAGCCGTCTTCGGATGTGCTGTTGCTCGACGGGCCG
GCTTCGGTGGCGGCCGCTCTCCGGGATGCCCGGCCCGGCCCACCCTCGGCGCCGACGGTGGCGGTTCTCGACGGG
CGGATGCTGTCGGCGCTCCAGACGGCAGCCCACGACGACTTCATTGCGAGCCAGTTCGGCGAGCTCATCTGTCGG
GTCGACTCGGTCATCTTCTGTCGGGCCACTCCTCCGCAAAAGGCGGCCCTCGTCGAGGTGGTCCGCAAGCAGCAG
CCCAAGAGCCTGACACTCGCCATGGGAGACGGCGCCAACGACGTGGGCATGCTGGAGACGGCTCACGTCGGCGTC
GGGATCTCGGGTCGCGAGGGACTGCAGGCCGCTCGCGTGTCCGACTATTCCATCGGCCAGTTCCGCTTCCTGGCG
CGGCTGCTGCTCGTTCACGGTCGATGGAACTACATGCGGACGGCGCGATTCATCCTGGAAACGTACTGGAAGGGG
GCCTTCTTCGTCATGATGCAGATGTGGTTCCAGATCTTCTGCGCGGGCGCCACGACCACGTCACTGTTTGAGAAC
TACAGCTTGATGTTCTTCAGCTTATTCATGTCGGGGCCGGCCCTCATCATCCCGGCTGTGCTGGATCAAGACCTA
TCGGCCCGGACTCTCCTGGCCAAGCCGGAGCTGTACAGGTCGGGTCCCTCGTGCCGGGCCTTCAACAGATATTTG
TACATGGGCTGGACGGTCATGGGGTGGCTGAGCAGCGTCGTGCTGTTTGGCATCATGTGGGGGGGGTTCCGGGGG
GTTTTGATCGATGACGATGGGTCCTTTTTCGCCTTTGGACATGCGCAGTTCGTCGTCGTCGTCATTTATTTGAAC
CTGAAGCTGCTCGTCTTGGAATGCTATAGAATCACCATCGTCAACCTCTACTGCTTCATCGTGGCCGTGAGCACC
CTCTTGATTGTGACGGCTGCGACTACGCAAGGATCGGAGCACAAGCTTGAGGCCTTTCACATGCGGGGGTCGGGG
GAGCACGTCTTTGGCCGGCTGCGGTGGTGGGCGACGATTCTGTGCGGGTTGGTGGCGGTGGTGATGGTGGACCTG
GCGGTGCAGGTGCTGCGGCGCGTCTTGTTCCCTTCGGATCTGGATGAGGAGATGAGGATTGAGAGGGAGGAGTTT
GGGGGGGAGAAGAGGGATGAGTTGGGGGAGAGGGAGAAGGGGTTAGGGATTGGGGGGGGTTTTGGGGTTGTTTTT
GGACGGGATTAA
Gene >Ophcf2|03535
ATGCTCGACCGTGAGCGCGGTTTGCCTCGTCCAGTTCAAGTGGCCCCCTCCAAGGTGGAGAGTATCTTTTCGACT
CTGGGCTCGGAATATGTTACCTTATTCCCCTGGCCGATGCGTCTGCGGCTTTACGTCCGACTCGTCGCCTGCCAT
CTTTTGGGCTTGAAGTGGGCGCTGCCGCAGCAAAAGGGGCGGCGGATTCCGCTTCTGGCCGGTAACGAGAACTTG
TTGGACGTGCGGACTGGCCTCCCCTACATGGGCAACCGCATTCGCACCAACCGGTATACGCTCATCAGCTTCCTG
CCCAAGCAGCTGTGGTTGCAGACGACGAGACCCCATGTCATTTGGTTCTGGTTATTATTTATTGTACAGTTGAAA
TTGCCTGCCATGGCTGCTGGCATCTGGAACACCCTCGGGCCGCTGCTGGCTTACACCTGTTTCTACATGTTGTGT
GACATGTGGCGGGATTACCGTCGGTATCAACTTGACAGAGAGGAGAATGGCAGTCGTGCCTTTGTGCTGGTCCGG
GGACGTCACGGCGAGAAAAAGACGAAGACAGACTGGCTGGTCGTCAAGTGGAAGAAGATTCGTGTCGGTGACGTG
GTCCGGCTGCTGCGAAACGAGGCCGCTCCGGCGGATCTGATCCTGCTGCACGCCTCTGGACCCGACGGCGTGGCG
TACATCGACACCATGGCTCTCGACGGTGAGACCAACCTCAAGTCCAAACAGGTTCCTCAGCCGCTGGCAGAACGT
TGTGCCACGGTGGCCGGCATCCGGACCGCCGACGCAGTCTTTACGTCCGAGGACCCGAATTCTGACCTGTACAGA
TACGAGGGCATGGCGACTGTCGGCGGCAGGATACTGCCCCTGTCGCAGTCCAACGTCGTCTATCGCGGCTCGACG
CTGCGCAACACAGACGAAGCCGTCGGGCTGGTCATCAACTCTGGCGAGGAATGCAAGATTCGTGTCAGCGCACGG
GACCATATCCGCAACAAGGTGTCTGCCTTGAACGTCGCCGCCAACAAGAAGATGGTATTTCAGATAAGCATCGCA
CTCGTCTTGTTAGCCGTCCTGATATGCTTCAATCTGGAGTGGCGGCACAGGTTCGCGTGCAAGGCGAGGACCTTG
GTAGGTGGAAGTAACTCGCTCAAGAACACTACCTTGAGCCACATCTTTATGCTATCGGAGCTGATTCCGCTGTCA
CTTTTCGTTGCCATCCAGTTCATCAGATGGGGGCAACTGTTCTTCATGCACGACGTGGAAATGTACGACCCGGCG
ACGGACACGCCCATGAAAGTCAACACGGACTCCATCCTCGAGGACCTGGGACAGGTGACGCATGTCTTTTCCGAC
AAGACGGGGACCATGACGGAGAACTCGATGCACTTTCGCAAGATGACGGTCGGCGGCGCGGCTTGTCTTCATCTG
CCCGACGGGGGGGCCGAAGACGAGGAGGTTCCAGAGATTAAGACGGAGGTTCTGATGGACTACGTCGGCCGCCAT
CCGGACACGGCATTCTCCCGCAGGACGAGACATCTGCTGCTGTGCATGGCGCTGTGTCACACGTGCCTATTGGAG
ACGACGCCCCAAAGACGGATCAAGTTCCTGGCCACGTCCCCGGACGAGCTGGCCCTGGTTGAGGCGGCTCGCGAT
CTGGGACTGGTGCTGACGAACCGGTCGGGGGGGGGGATGTCGATTCGGAGGAGCGACGACGGCAGTGTCGAGAAA
TACCAAGTGTTGGATGTCATCGAGTTCAGCAGCGCGCGCAAGAGGATGTCGATCGTGGTGCGGATGCCGGACGGG
AGAATCCACGTCATCTGCAAGGGCGCTGATGCCGTCATGACGGAAAGACTGGCGCTGAGAGAGGCAGCTGAAGAA
AAGACCAAGCAGATCGGGCAGCGCAACAACCAGCGGAAGACTATCGAGCTTGAGCGCGAGAGGCGGATGATGAGG
ACGTCAGACATGGATCGGGACCGGGAGAGGAGCCGCAGGAGAACATTTGAGCTGAGCTGGTCCCGGCGAGGGACG
CGGGAGCGGAGCCGGGAGAGGCGCAAGACGTTTGAGCTGGGCCGGATAAGCAGCAGGGTAGCGGAGAAGCGACGA
CGACTGACGGATGCCGACGAGACGCTGGCGGCTGACGACGAGGCTGTCCTGAGCCGCTGCCTGGAGCACGTCGAC
GACTTCTCGACCGAGGGCCTACGCACGCTCATGTACGCCTCTCGAGTCGTGAGCGAGGGGGAATACAAGGCCTAG
AAGGCGTCGTACAACGCGGCCCAGACGAGCCCCGTCGAGCGCCAGAAACGGGTGGAGGAAGTGGGCGGTCTGCTC
GAGACGGACCTGGACTTGGCGGGCGCGACGGCCATCGAGGACAAGCTACAGAAGGGGGTGGCAGAGACGGTGGAC
CAGCTGCGGCGGGCCGGTATCAAGGTGTGGATGCTGACGGGCGACAAGCGAGAGACGGCCATCAACATCGGGCAC
GCGGCCGGTCTTTGCAAGCCGTCTTCGGATGTGCTGTTGCTCGACGGGCCGGCTTCGGTGGCGGCCGCTCTCCGG
GATGCCCGGCCCGGCCCACCCTCGGCGCCGACGGTGGCGGTTCTCGACGGGCGGATGCTGTCGGCGCTCCAGACG
GCAGCCCACGACGACTTCATTGCGAGCCAGTTCGGCGAGCTCATCTGTCGGGTCGACTCGGTCATCTTCTGTCGG
GCCACTCCTCCGCAAAAGGCGGCCCTCGTCGAGGTGGTCCGCAAGCAGCAGCCCAAGAGCCTGACACTCGCCATG
GGAGACGGCGCCAACGACGTGGGCATGCTGGAGACGGCTCACGTCGGCGTCGGGATCTCGGGTCGCGAGGGACTG
CAGGCCGCTCGCGTGTCCGACTATTCCATCGGCCAGTTCCGCTTCCTGGCGCGGCTGCTGCTCGTTCACGGTCGA
TGGAACTACATGCGGACGGCGCGATTCATCCTGGAAACGTACTGGAAGGGGGCCTTCTTCGTCATGATGCAGATG
TGGTTCCAGATCTTCTGCGCGGGCGCCACGACCACGTCACTGTTTGAGAACTACAGCTTGATGTTCTTCAGCTTA
TTCATGTCGGGGCCGGCCCTCATCATCCCGGCTGTGCTGGATCAAGACCTATCGGCCCGGACTCTCCTGGCCAAG
CCGGAGCTGTACAGGTCGGGTCCCTCGTGCCGGGCCTTCAACAGATATTTGTACATGGGCTGGACGGTCATGGGG
TGGCTGAGCAGCGTCGTGCTGTTTGGCATCATGTGGGGGGGGTTCCGGGGGGTTTTGATCGATGACGATGGGTCC
TTTTTCGCCTTTGGACATGCGCAGTTCGTCGTCGTCGTCATTTATTTGAACCTGAAGCTGCTGTCCGTCTTTTCC
TTGTTCTCCGCTGTTTTCTCGTCTTTTGCTGACATGGGACGACGCAGCGTCTTGGAATGCTATAGAATCACCATC
GTCAACCTCTACTGCTTCATCGTGGCCGTGAGCACCCTCTTGATTGTGACGGCTGCGACTACGCAAGGATCGGAG
CACAAGCTTGAGGCCTTTCACATGCGGGGGTCGGGGGAGCACGTCTTTGGCCGGCTGCGGTGGTGGGCGACGATT
CTGTGCGGGTTGGTGGCGGTGGTGATGGTGGACCTGGCGGTGCAGGTGCTGCGGCGCGTCTTGTTCCCTTCGGAT
CTGGATGAGGAGATGAGGATTGAGAGGGAGGAGTTTGGGGGGGAGAAGAGGGATGAGTTGGGGGAGAGGGAGAAG
GGGTTAGGGATTGGGGGGGGTTTTGGGGTTGTTTTTGGACGGGATTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail