Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03522
Gene name
Locationscaffold_03:2935484..2936243
Strand+
Gene length (bp)759
Transcript length (bp)639
Coding sequence length (bp)639
Protein length (aa) 213

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.0726 0.0932 0.9252 0.0797 0.0606 0.0209 0.0909 0.1998 0.082 0.004

SignalP

SignalP signal predicted Location Score
Yes 1 - 18 0.999682

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup81
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5285
Ophiocordyceps australis 1348a (Ghana) OphauG2|6783
Ophiocordyceps australis map64 (Brazil) OphauB2|3223
Ophiocordyceps australis map64 (Brazil) OphauB2|5049
Ophiocordyceps australis map64 (Brazil) OphauB2|5050
Ophiocordyceps australis map64 (Brazil) OphauB2|6225
Ophiocordyceps camponoti-floridani Ophcf2|03522 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|06147
Ophiocordyceps camponoti-rufipedis Ophun1|3121
Ophiocordyceps camponoti-rufipedis Ophun1|4618
Ophiocordyceps kimflemingae Ophio5|1911
Ophiocordyceps kimflemingae Ophio5|8477
Ophiocordyceps subramaniannii Hirsu2|184
Ophiocordyceps subramaniannii Hirsu2|7612
Ophiocordyceps subramaniannii Hirsu2|7613

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03522
MARLQTLLVISWAAQAYSTSPIIGVNTFIPQWLIEVFPGQPYQLLNGTIQEVERKAMELNPRWHEYYIVNSTRNQ
AVSDQQKMTRRHFHSCTKFPVKSLNCKNNPQNWRPANVGYIFDGIHWLMGREGIPQSQPGPGTCGRVSCSYSSAI
WWCNDDSGPKSLNSFTEIARGANCILDSCPHIPGGQHRFYTWGQVFHPDNWNVIVREDKHNC*
Coding >Ophcf2|03522
ATGGCTCGTCTGCAGACGCTTCTTGTCATTTCCTGGGCTGCACAGGCGTACAGTACGAGCCCCATCATAGGTGTC
AATACCTTTATCCCGCAATGGTTGATCGAAGTCTTCCCCGGCCAACCGTATCAATTGCTCAACGGGACCATCCAG
GAAGTCGAGCGCAAGGCCATGGAGCTGAATCCCAGGTGGCATGAGTACTATATTGTCAACTCGACCAGGAACCAG
GCCGTTTCCGATCAGCAGAAGATGACGCGTCGTCACTTTCACAGTTGTACCAAGTTTCCCGTCAAGAGCTTGAAC
TGCAAGAACAATCCGCAGAACTGGAGACCGGCCAACGTCGGCTACATATTCGATGGCATCCACTGGCTGATGGGG
AGAGAAGGCATCCCGCAAAGCCAGCCCGGTCCCGGGACTTGTGGCCGTGTCAGCTGTTCCTATTCATCCGCCATC
TGGTGGTGCAACGATGATTCAGGGCCCAAAAGCCTTAATTCCTTTACAGAAATCGCCAGAGGTGCCAACTGCATC
CTCGACTCATGTCCGCATATACCGGGTGGTCAGCACAGGTTCTACACATGGGGGCAGGTATTTCACCCGGATAAC
TGGAATGTTATTGTCAGAGAAGACAAGCACAACTGCTAG
Transcript >Ophcf2|03522
ATGGCTCGTCTGCAGACGCTTCTTGTCATTTCCTGGGCTGCACAGGCGTACAGTACGAGCCCCATCATAGGTGTC
AATACCTTTATCCCGCAATGGTTGATCGAAGTCTTCCCCGGCCAACCGTATCAATTGCTCAACGGGACCATCCAG
GAAGTCGAGCGCAAGGCCATGGAGCTGAATCCCAGGTGGCATGAGTACTATATTGTCAACTCGACCAGGAACCAG
GCCGTTTCCGATCAGCAGAAGATGACGCGTCGTCACTTTCACAGTTGTACCAAGTTTCCCGTCAAGAGCTTGAAC
TGCAAGAACAATCCGCAGAACTGGAGACCGGCCAACGTCGGCTACATATTCGATGGCATCCACTGGCTGATGGGG
AGAGAAGGCATCCCGCAAAGCCAGCCCGGTCCCGGGACTTGTGGCCGTGTCAGCTGTTCCTATTCATCCGCCATC
TGGTGGTGCAACGATGATTCAGGGCCCAAAAGCCTTAATTCCTTTACAGAAATCGCCAGAGGTGCCAACTGCATC
CTCGACTCATGTCCGCATATACCGGGTGGTCAGCACAGGTTCTACACATGGGGGCAGGTATTTCACCCGGATAAC
TGGAATGTTATTGTCAGAGAAGACAAGCACAACTGCTAG
Gene >Ophcf2|03522
ATGGCTCGTCTGCAGACGCTTCTTGTCATTTCCTGGGCTGCACAGGTAGGGTAGAGCCGTCGACGTTTTCCGTCC
ATCATGTCTAATAATATCTCGGTTCAAGGCGTACAGTACGAGCCCCATCATAGGTGTCAATACCTTTATCCCGCA
ATGGTTGATCGAAGTCTTCCCCGGCCAACCGTATCAATTGCTCAACGGGACCATCCAGGAAGTCGAGCGCAAGGC
CATGGAGCTGAATCCCAGGTGGCATGAGTACTATATTGTCAACTCGACCAGGAACCAGGCCGTTTCCGATCAGCA
GAAGATGACGCGTCGTCACTTTCACAGTTGTACCAAGTTTCCCGTCAAGAGCTTGAACTGCAAGAACAATCCGCA
GAACTGGAGACCGGCCAACGTCGGCTACATATTCGATGGCATCCACTGGCTGATGGGGAGAGAAGGCATCCCGCA
AAGCCAGCCCGGTCCCGGGACTTGTGGCCGTGTCAGCTGTTCCTATTCATCCGCCATCTGGTGGTGCAACGATGT
GTGTTTTTGTCTCTGACGGTGTGACTCGGAGGGTAGCCCGGACTGACGCAGAGAGAGCAGGATTCAGGGCCCAAA
AGCCTTAATTCCTTTACAGAAATCGCCAGAGGTGCCAACTGCATCCTCGACTCATGTCCGCATATACCGGGTGGT
CAGCACAGGTTCTACACATGGGGGCAGGTATTTCACCCGGATAACTGGAATGTTATTGTCAGAGAAGACAAGCAC
AACTGCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail