Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03514
Gene name
Locationscaffold_03:2913788..2915297
Strand-
Gene length (bp)1509
Transcript length (bp)1377
Coding sequence length (bp)1377
Protein length (aa) 459

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16491 Peptidase_M48_N CAAX prenyl protease N-terminal, five membrane helices 1.2E-61 40 224
PF01435 Peptidase_M48 Peptidase family M48 3.6E-47 227 431

GO

GO Term Description Terminal node
GO:0004222 metalloendopeptidase activity Yes
GO:0006508 proteolysis Yes
GO:0008233 peptidase activity No
GO:0016787 hydrolase activity No
GO:0140096 catalytic activity, acting on a protein No
GO:0003674 molecular_function No
GO:0004175 endopeptidase activity No
GO:0043170 macromolecule metabolic process No
GO:0008150 biological_process No
GO:0003824 catalytic activity No
GO:0006807 nitrogen compound metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0008237 metallopeptidase activity No
GO:0008152 metabolic process No
GO:0019538 protein metabolic process No
GO:0044238 primary metabolic process No
GO:0071704 organic substance metabolic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Endoplasmic reticulum Peroxisomal targeting signal 0.1834 0.094 0.0143 0.0353 0.5952 0.0457 0.6937 0.1798 0.2273 0.4909

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 114 136 22
2 171 188 17
3 195 217 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1767
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3274
Ophiocordyceps australis map64 (Brazil) OphauB2|7949
Ophiocordyceps camponoti-floridani Ophcf2|03514 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4611
Ophiocordyceps kimflemingae Ophio5|4891
Ophiocordyceps subramaniannii Hirsu2|1678

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03514
MDFLQRLSRFLDRPLFPWKKLILGFSIGQYVFESLLTLRQYRVLLQRKPPAVLAKEVSQETFDKSQAYGRAKARF
ELINGLWGQVQNVAFVQMDLLPALWAWCGALVRLYAPAWFAGEIGHSIVFVYVFILLQQLLGLPGRIYNTFVLEE
SFGFNKQTPKLFAVDMVKTNILTAVIMPPILAAFLAIIRRTGNQFVFYLWVFSAALQLFTTTAYPMFIQPLFNKL
SPLDEGELKKRVEELAAKQTFPLQDLFVIDGSKRSAHSNAYFYGLPWKKHIVIYDTLIEKTETSEIVAILAHELG
HWKLGHTTRLFAIAQVHLLYIFSLFSVFVNNNSLYSAFGFHHTHPIVIGFILFSDALSPMDCLLKLLLNMLSRKF
EFQADDFANRLGHRAQLAASLIKLHAQNLSTMDADPIYATYHYSHPHLSERLKALEWTPSVALTSEKDKDKDQAV
KASGRDEM*
Coding >Ophcf2|03514
ATGGATTTCCTTCAGCGCCTCTCACGGTTCCTCGACCGCCCGCTCTTCCCCTGGAAGAAGCTGATCCTCGGCTTC
TCCATCGGCCAATACGTATTCGAATCACTCCTCACTTTACGGCAATACCGCGTGCTTCTCCAGCGAAAGCCGCCA
GCCGTGCTAGCAAAGGAGGTATCGCAGGAGACGTTTGACAAGTCTCAGGCGTACGGACGGGCCAAGGCGCGCTTC
GAACTCATCAATGGGCTTTGGGGCCAGGTGCAGAACGTGGCATTCGTGCAGATGGATCTTCTGCCTGCGCTGTGG
GCCTGGTGTGGTGCGCTGGTGCGGTTGTATGCTCCTGCTTGGTTTGCTGGCGAGATTGGCCATTCCATCGTCTTC
GTCTACGTCTTTATCCTGCTGCAACAGCTACTCGGCTTACCGGGCCGCATCTACAACACTTTTGTTCTCGAGGAG
TCCTTTGGTTTCAACAAGCAGACGCCCAAGCTGTTCGCGGTGGACATGGTCAAGACCAACATCCTGACAGCCGTC
ATCATGCCTCCCATCTTGGCAGCTTTCCTGGCCATAATCCGCCGCACGGGCAATCAGTTCGTCTTCTACCTCTGG
GTCTTTTCCGCCGCCCTCCAGCTCTTCACCACGACGGCCTACCCCATGTTCATCCAGCCGCTCTTCAATAAGCTT
TCGCCCCTGGACGAGGGCGAGCTGAAGAAGAGAGTGGAAGAGCTGGCTGCCAAGCAGACGTTTCCGCTGCAAGAC
CTCTTCGTCATCGACGGGAGCAAGCGGAGCGCTCACTCCAACGCCTACTTCTACGGCCTGCCGTGGAAGAAGCAC
ATTGTCATTTACGACACGCTCATCGAGAAGACGGAAACATCGGAGATTGTCGCCATCTTGGCCCACGAGCTCGGT
CACTGGAAACTAGGCCACACCACCCGCTTATTCGCCATTGCACAGGTCCACCTCCTCTACATCTTCAGCCTCTTC
TCCGTCTTCGTCAACAACAACTCCCTCTACTCCGCCTTCGGCTTCCACCACACCCACCCCATCGTAATCGGCTTC
ATCCTCTTCTCAGACGCCCTCTCCCCAATGGACTGCCTCCTCAAGCTCCTCCTAAACATGCTCTCCCGCAAATTC
GAATTCCAAGCCGACGACTTCGCCAACCGCCTCGGCCACCGCGCCCAGCTCGCCGCCTCGCTCATCAAGCTCCAC
GCCCAGAACCTAAGCACCATGGACGCCGATCCCATCTACGCTACCTACCACTACTCCCACCCCCATCTCTCCGAG
AGGCTCAAGGCTCTCGAGTGGACGCCCAGCGTGGCCCTTACGTCGGAGAAGGATAAGGATAAGGATCAGGCTGTT
AAGGCGTCGGGGCGGGATGAGATGTAG
Transcript >Ophcf2|03514
ATGGATTTCCTTCAGCGCCTCTCACGGTTCCTCGACCGCCCGCTCTTCCCCTGGAAGAAGCTGATCCTCGGCTTC
TCCATCGGCCAATACGTATTCGAATCACTCCTCACTTTACGGCAATACCGCGTGCTTCTCCAGCGAAAGCCGCCA
GCCGTGCTAGCAAAGGAGGTATCGCAGGAGACGTTTGACAAGTCTCAGGCGTACGGACGGGCCAAGGCGCGCTTC
GAACTCATCAATGGGCTTTGGGGCCAGGTGCAGAACGTGGCATTCGTGCAGATGGATCTTCTGCCTGCGCTGTGG
GCCTGGTGTGGTGCGCTGGTGCGGTTGTATGCTCCTGCTTGGTTTGCTGGCGAGATTGGCCATTCCATCGTCTTC
GTCTACGTCTTTATCCTGCTGCAACAGCTACTCGGCTTACCGGGCCGCATCTACAACACTTTTGTTCTCGAGGAG
TCCTTTGGTTTCAACAAGCAGACGCCCAAGCTGTTCGCGGTGGACATGGTCAAGACCAACATCCTGACAGCCGTC
ATCATGCCTCCCATCTTGGCAGCTTTCCTGGCCATAATCCGCCGCACGGGCAATCAGTTCGTCTTCTACCTCTGG
GTCTTTTCCGCCGCCCTCCAGCTCTTCACCACGACGGCCTACCCCATGTTCATCCAGCCGCTCTTCAATAAGCTT
TCGCCCCTGGACGAGGGCGAGCTGAAGAAGAGAGTGGAAGAGCTGGCTGCCAAGCAGACGTTTCCGCTGCAAGAC
CTCTTCGTCATCGACGGGAGCAAGCGGAGCGCTCACTCCAACGCCTACTTCTACGGCCTGCCGTGGAAGAAGCAC
ATTGTCATTTACGACACGCTCATCGAGAAGACGGAAACATCGGAGATTGTCGCCATCTTGGCCCACGAGCTCGGT
CACTGGAAACTAGGCCACACCACCCGCTTATTCGCCATTGCACAGGTCCACCTCCTCTACATCTTCAGCCTCTTC
TCCGTCTTCGTCAACAACAACTCCCTCTACTCCGCCTTCGGCTTCCACCACACCCACCCCATCGTAATCGGCTTC
ATCCTCTTCTCAGACGCCCTCTCCCCAATGGACTGCCTCCTCAAGCTCCTCCTAAACATGCTCTCCCGCAAATTC
GAATTCCAAGCCGACGACTTCGCCAACCGCCTCGGCCACCGCGCCCAGCTCGCCGCCTCGCTCATCAAGCTCCAC
GCCCAGAACCTAAGCACCATGGACGCCGATCCCATCTACGCTACCTACCACTACTCCCACCCCCATCTCTCCGAG
AGGCTCAAGGCTCTCGAGTGGACGCCCAGCGTGGCCCTTACGTCGGAGAAGGATAAGGATAAGGATCAGGCTGTT
AAGGCGTCGGGGCGGGATGAGATGTAG
Gene >Ophcf2|03514
ATGGATTTCCTTCAGGTAACGGCTCCTACCTCGCCTCTCGCCCCCAGTGCTTCTCCCCCTCGCTAACCCCAACAC
CACACCAACAGCGCCTCTCACGGTTCCTCGACCGCCCGCTCTTCCCCTGGAAGAAGCTGATCCTCGGCTTCTCCA
TCGGCCAATACGTATTCGAATCACTCCTCACTTTACGGCAATACCGCGTGCTTCTCCAGCGAAAGCCGCCAGCCG
TGCTAGCAAAGGAGGTATCGCAGGAGACGTTTGACAAGTCTCAGGCGTACGGACGGGCCAAGGCGCGCTTCGAAC
TCATCAATGGGCTTTGGGGCCAGGTGCAGAACGTGGCATTCGTGCAGATGGATCTTCTGCCTGCGCTGTGGGCCT
GGTGTGGTGCGCTGGTGCGGTTGTATGCTCCTGCTTGGTTTGCTGGCGAGATTGGCCATTCCATCGTCTTCGTCT
ACGTCTTTATCCTGCTGCAACAGCTACTCGGCTTACCGGGCCGCATCTACAACACTTTTGTTCTCGAGGAGTCCT
TTGGTTTCAACAAGCAGACGCCCAAGCTGTTCGCGGTGGACATGGTCAAGACCAACATCCTGACAGCCGTCATCA
TGCCTCCCATCTTGGCAGCTTTCCTGGCCATAATCCGCCGCACGGGCAATCAGTTCGTCTTCTACCTCTGGGTCT
TTTCCGCCGCCCTCCAGCTCTTCACCACGACGGCCTACCCCATGTTCATCCAGCCGCTCTTCAATAAGCTTTCGC
CCCTGGACGAGGGCGAGCTGAAGAAGAGAGTGGAAGAGCTGGCTGCCAAGCAGACGTTTCCGCTGCAAGACCTCT
TCGTCATCGACGGGAGCAAGCGGAGCGCTCACTCCAACGCCTACTTCTACGGCCTGCCGTGGAAGAAGCACATTG
TCATTTACGACACGCTCATCGAGAAGACGGAAACATCGGAGATTGTCGCCATCTTGGCCCACGAGCTCGGTCACT
GGAAACTAGGCCACACCACCCGCTTATTCGCCATTGCACAGGTACATCTTCCTCCCTCTCTCACATCCCCCAAGA
ATTCCAGAGCTAACGAGCAAATCCAAGGTCCACCTCCTCTACATCTTCAGCCTCTTCTCCGTCTTCGTCAACAAC
AACTCCCTCTACTCCGCCTTCGGCTTCCACCACACCCACCCCATCGTAATCGGCTTCATCCTCTTCTCAGACGCC
CTCTCCCCAATGGACTGCCTCCTCAAGCTCCTCCTAAACATGCTCTCCCGCAAATTCGAATTCCAAGCCGACGAC
TTCGCCAACCGCCTCGGCCACCGCGCCCAGCTCGCCGCCTCGCTCATCAAGCTCCACGCCCAGAACCTAAGCACC
ATGGACGCCGATCCCATCTACGCTACCTACCACTACTCCCACCCCCATCTCTCCGAGAGGCTCAAGGCTCTCGAG
TGGACGCCCAGCGTGGCCCTTACGTCGGAGAAGGATAAGGATAAGGATCAGGCTGTTAAGGCGTCGGGGCGGGAT
GAGATGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail