Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03507
Gene name
Locationscaffold_03:2885046..2887388
Strand+
Gene length (bp)2342
Transcript length (bp)2238
Coding sequence length (bp)2238
Protein length (aa) 746

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09734 Tau95 RNA polymerase III transcription factor (TF)IIIC subunit HTH domain 1.5E-37 236 379
PF17682 Tau95_N Tau95 Triple barrel domain 1.4E-33 57 196

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.2705 0.8941 0.0643 0.0163 0.0636 0.0096 0.0282 0.049 0.028 0.0012

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3768
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6856
Ophiocordyceps australis map64 (Brazil) OphauB2|1863
Ophiocordyceps camponoti-floridani Ophcf2|03507 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|2726
Ophiocordyceps kimflemingae Ophio5|7547
Ophiocordyceps subramaniannii Hirsu2|7347

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03507
MASSPASSPAAVTGSARDQSPEASRAPDDDVWDEADAPDDPPDDGAPRYPVASRQLVAVEIPAVVQNIDRAVKAF
GRVPSLAHVMDPQRSSFPLYLNPESPFCPPIRSHNARSHNIVLKITVPKRTGRKRKRGSDGPWEGDVEMPSEGER
VSSIARLDQPFILRRKLADNIDSYEVDVVGVIRHTHRFRGLADFYWHMPKSDFAQRYVDQVLPGDVKRLRTFKFK
PGTDRGPNVDILPPPLFTHMTLPFNYNYSQNPLVRTTEDGATVNLSAVKQVGYFIGAEEPAPEGPQAPPDMTDVR
TVEVIAELEDAFNERPIWTRRSLLNYLGGKLRNWNELKKYLNYTAYQFKGGPWRDGVVQYGVDPRTDAKYRVYQT
LMFKLATKDFKGRTWQSMRRLQAILGREAGTDGSQSHLFNGESYSDDGKVWQVCDITDPLLKEMLEEAAVRPTCD
VNSGWYHGGLWAKVKAVMKTKLVAIRFGRQLTRGDFAATLRCGDETPTKATSNWNLPLPKLKLTDEEMMVLRGRR
VAKKETTYASRGRDPRRGQKASDTLMASRPAGDSQATVSGTGLDEDGGEGEVEIEDEEEDEEEDEEEDEEEDEEE
VEGEVEGEAESDDGSGEDDDDDVELDEGEDNEDDLGDDEGDDEDDDLGEEDDNEDEFYGYEFNNKAQHDDEEMAE
GDYGNVGLTSGHYGEYGLDLDDDDEDDEDDDDMNEVQRQIYPEPPAYGLDEDDAGQDDGLANRAVYPELD*
Coding >Ophcf2|03507
ATGGCATCGTCGCCCGCCTCATCACCGGCAGCAGTAACGGGAAGCGCTCGCGATCAAAGTCCTGAAGCTTCGCGG
GCCCCCGACGATGACGTCTGGGACGAGGCCGATGCCCCTGATGATCCCCCTGATGACGGCGCCCCGCGATATCCT
GTGGCGTCGCGACAGCTCGTCGCTGTCGAGATTCCGGCCGTGGTGCAGAACATAGACCGTGCCGTCAAGGCCTTT
GGAAGAGTCCCTTCTCTGGCTCATGTCATGGATCCCCAACGGAGCTCTTTTCCGTTGTACTTGAACCCAGAGAGT
CCATTTTGCCCTCCCATCCGCTCGCACAACGCGCGGTCGCACAATATTGTTCTTAAAATCACCGTTCCGAAGCGT
ACCGGCCGCAAGAGGAAGCGCGGCTCCGACGGCCCCTGGGAAGGCGACGTCGAGATGCCGTCTGAGGGAGAGCGC
GTATCCTCCATCGCGAGACTCGACCAACCCTTCATTCTACGGCGGAAGCTGGCGGATAACATCGACAGCTACGAG
GTCGATGTCGTGGGCGTCATTCGGCATACACACCGGTTTCGCGGGCTGGCCGACTTTTACTGGCATATGCCCAAG
TCCGATTTCGCCCAGAGATATGTCGATCAGGTTCTGCCTGGAGACGTGAAGCGTCTCCGAACCTTCAAGTTCAAG
CCCGGCACCGACCGCGGCCCCAACGTCGACATCCTTCCGCCTCCTCTCTTCACGCACATGACGTTGCCTTTCAAC
TACAACTACTCTCAGAACCCGCTCGTGCGGACGACAGAAGATGGCGCGACGGTGAATCTGTCGGCCGTCAAGCAA
GTCGGCTACTTCATCGGCGCCGAGGAGCCTGCCCCTGAGGGGCCACAAGCTCCGCCGGACATGACGGATGTCAGG
ACGGTCGAGGTAATTGCCGAGTTGGAGGATGCCTTTAACGAGCGACCCATTTGGACGCGGCGATCGCTACTGAAT
TACCTGGGAGGTAAGCTGCGCAACTGGAACGAGCTGAAAAAATACCTCAACTATACGGCCTACCAATTCAAGGGC
GGGCCCTGGAGGGACGGCGTGGTGCAGTACGGTGTCGATCCGAGGACAGACGCCAAGTATCGCGTCTACCAGACG
CTCATGTTCAAGCTGGCGACCAAGGACTTTAAGGGGCGGACATGGCAGTCAATGCGAAGATTGCAGGCTATCCTA
GGGCGAGAGGCGGGCACCGACGGCAGCCAGAGCCATCTGTTCAACGGCGAGTCGTACTCTGATGACGGCAAGGTG
TGGCAGGTGTGCGACATTACGGACCCGCTGCTCAAGGAGATGCTGGAGGAGGCAGCGGTGCGGCCGACGTGTGAC
GTCAACAGTGGCTGGTATCACGGCGGGCTGTGGGCCAAGGTCAAGGCGGTGATGAAGACGAAGCTGGTGGCGATC
CGGTTCGGGCGTCAACTGACGAGGGGGGACTTTGCGGCGACGCTGCGGTGCGGCGACGAGACGCCGACCAAGGCG
ACGAGCAATTGGAATCTTCCGCTGCCGAAGCTAAAGCTTACTGACGAAGAGATGATGGTGCTACGCGGCCGCAGA
GTTGCCAAGAAGGAGACGACGTATGCATCGCGAGGGCGTGATCCGCGGAGGGGACAGAAGGCGTCGGATACGTTG
ATGGCGTCGAGACCGGCTGGGGATTCGCAGGCGACTGTGAGCGGCACTGGGTTGGACGAGGATGGAGGGGAGGGT
GAAGTCGAGATCGAGGACGAGGAAGAGGACGAGGAAGAGGACGAGGAAGAGGACGAGGAAGAGGACGAGGAAGAG
GTCGAAGGAGAGGTCGAAGGAGAGGCCGAGAGTGACGACGGTTCGGGTGAAGATGATGACGACGATGTTGAGTTG
GATGAGGGCGAGGACAACGAAGATGATTTGGGCGACGATGAAGGCGACGATGAAGACGATGACTTGGGCGAGGAA
GACGACAACGAAGACGAGTTTTACGGATACGAATTCAACAACAAGGCTCAGCACGACGATGAAGAGATGGCCGAA
GGCGACTATGGCAACGTTGGCTTGACCAGCGGCCACTACGGCGAATACGGCCTCGATCTAGACGACGATGATGAA
GACGACGAAGATGACGATGATATGAACGAGGTTCAACGCCAGATATATCCCGAGCCGCCCGCCTACGGCCTCGAC
GAGGATGATGCTGGCCAGGACGATGGGTTGGCGAACCGCGCGGTGTATCCGGAACTGGACTAG
Transcript >Ophcf2|03507
ATGGCATCGTCGCCCGCCTCATCACCGGCAGCAGTAACGGGAAGCGCTCGCGATCAAAGTCCTGAAGCTTCGCGG
GCCCCCGACGATGACGTCTGGGACGAGGCCGATGCCCCTGATGATCCCCCTGATGACGGCGCCCCGCGATATCCT
GTGGCGTCGCGACAGCTCGTCGCTGTCGAGATTCCGGCCGTGGTGCAGAACATAGACCGTGCCGTCAAGGCCTTT
GGAAGAGTCCCTTCTCTGGCTCATGTCATGGATCCCCAACGGAGCTCTTTTCCGTTGTACTTGAACCCAGAGAGT
CCATTTTGCCCTCCCATCCGCTCGCACAACGCGCGGTCGCACAATATTGTTCTTAAAATCACCGTTCCGAAGCGT
ACCGGCCGCAAGAGGAAGCGCGGCTCCGACGGCCCCTGGGAAGGCGACGTCGAGATGCCGTCTGAGGGAGAGCGC
GTATCCTCCATCGCGAGACTCGACCAACCCTTCATTCTACGGCGGAAGCTGGCGGATAACATCGACAGCTACGAG
GTCGATGTCGTGGGCGTCATTCGGCATACACACCGGTTTCGCGGGCTGGCCGACTTTTACTGGCATATGCCCAAG
TCCGATTTCGCCCAGAGATATGTCGATCAGGTTCTGCCTGGAGACGTGAAGCGTCTCCGAACCTTCAAGTTCAAG
CCCGGCACCGACCGCGGCCCCAACGTCGACATCCTTCCGCCTCCTCTCTTCACGCACATGACGTTGCCTTTCAAC
TACAACTACTCTCAGAACCCGCTCGTGCGGACGACAGAAGATGGCGCGACGGTGAATCTGTCGGCCGTCAAGCAA
GTCGGCTACTTCATCGGCGCCGAGGAGCCTGCCCCTGAGGGGCCACAAGCTCCGCCGGACATGACGGATGTCAGG
ACGGTCGAGGTAATTGCCGAGTTGGAGGATGCCTTTAACGAGCGACCCATTTGGACGCGGCGATCGCTACTGAAT
TACCTGGGAGGTAAGCTGCGCAACTGGAACGAGCTGAAAAAATACCTCAACTATACGGCCTACCAATTCAAGGGC
GGGCCCTGGAGGGACGGCGTGGTGCAGTACGGTGTCGATCCGAGGACAGACGCCAAGTATCGCGTCTACCAGACG
CTCATGTTCAAGCTGGCGACCAAGGACTTTAAGGGGCGGACATGGCAGTCAATGCGAAGATTGCAGGCTATCCTA
GGGCGAGAGGCGGGCACCGACGGCAGCCAGAGCCATCTGTTCAACGGCGAGTCGTACTCTGATGACGGCAAGGTG
TGGCAGGTGTGCGACATTACGGACCCGCTGCTCAAGGAGATGCTGGAGGAGGCAGCGGTGCGGCCGACGTGTGAC
GTCAACAGTGGCTGGTATCACGGCGGGCTGTGGGCCAAGGTCAAGGCGGTGATGAAGACGAAGCTGGTGGCGATC
CGGTTCGGGCGTCAACTGACGAGGGGGGACTTTGCGGCGACGCTGCGGTGCGGCGACGAGACGCCGACCAAGGCG
ACGAGCAATTGGAATCTTCCGCTGCCGAAGCTAAAGCTTACTGACGAAGAGATGATGGTGCTACGCGGCCGCAGA
GTTGCCAAGAAGGAGACGACGTATGCATCGCGAGGGCGTGATCCGCGGAGGGGACAGAAGGCGTCGGATACGTTG
ATGGCGTCGAGACCGGCTGGGGATTCGCAGGCGACTGTGAGCGGCACTGGGTTGGACGAGGATGGAGGGGAGGGT
GAAGTCGAGATCGAGGACGAGGAAGAGGACGAGGAAGAGGACGAGGAAGAGGACGAGGAAGAGGACGAGGAAGAG
GTCGAAGGAGAGGTCGAAGGAGAGGCCGAGAGTGACGACGGTTCGGGTGAAGATGATGACGACGATGTTGAGTTG
GATGAGGGCGAGGACAACGAAGATGATTTGGGCGACGATGAAGGCGACGATGAAGACGATGACTTGGGCGAGGAA
GACGACAACGAAGACGAGTTTTACGGATACGAATTCAACAACAAGGCTCAGCACGACGATGAAGAGATGGCCGAA
GGCGACTATGGCAACGTTGGCTTGACCAGCGGCCACTACGGCGAATACGGCCTCGATCTAGACGACGATGATGAA
GACGACGAAGATGACGATGATATGAACGAGGTTCAACGCCAGATATATCCCGAGCCGCCCGCCTACGGCCTCGAC
GAGGATGATGCTGGCCAGGACGATGGGTTGGCGAACCGCGCGGTGTATCCGGAACTGGACTAG
Gene >Ophcf2|03507
ATGGCATCGTCGCCCGCCTCATCACCGGCAGCAGTAACGGGAAGCGCTCGCGATCAAAGTCCTGAAGCTTCGCGG
GCCCCCGACGATGACGTCTGGGACGAGGCCGATGCCCCTGATGATCCCCCTGATGACGGCGCCCCGCGATATCCT
GTGGCGTCGCGACAGCTCGTCGCTGTCGAGATTCCGGCCGTGGTGCAGAACATAGACCGTGCCGTCAAGGCCTTT
GGAAGAGTCCCTTCTCTGGCTCATGTGAGTCTGTGTATCCCGTCTCTCGGGCTCGCAGCTCACAAGGGTTGCATG
CAGGTCATGGATCCCCAACGGAGCTCTTTTCCGTTGTACTTGAACCCAGAGAGTCCATTTTGCCCTCCCATCCGC
TCGCACAACGCGCGGTCGCACAATATTGTTCTTAAAATCACCGTTCCGAAGCGTACCGGCCGCAAGAGGAAGCGC
GGCTCCGACGGCCCCTGGGAAGGCGACGTCGAGATGCCGTCTGAGGGAGAGCGCGTATCCTCCATCGCGAGACTC
GACCAACCCTTCATTCTACGGCGGAAGCTGGCGGATAACATCGACAGCTACGAGGTCGATGTCGTGGGCGTCATT
CGGCATACACACCGGTTTCGCGGGCTGGCCGACTTTTACTGGCATATGCCCAAGTCCGATTTCGCCCAGAGATAT
GTCGATCAGGTTCTGCCTGGAGACGGTATGCGCGCAATCCTTATTCTGAAGTCCGCTGCTGATGAGTCCGCGCAG
TGAAGCGTCTCCGAACCTTCAAGTTCAAGCCCGGCACCGACCGCGGCCCCAACGTCGACATCCTTCCGCCTCCTC
TCTTCACGCACATGACGTTGCCTTTCAACTACAACTACTCTCAGAACCCGCTCGTGCGGACGACAGAAGATGGCG
CGACGGTGAATCTGTCGGCCGTCAAGCAAGTCGGCTACTTCATCGGCGCCGAGGAGCCTGCCCCTGAGGGGCCAC
AAGCTCCGCCGGACATGACGGATGTCAGGACGGTCGAGGTAATTGCCGAGTTGGAGGATGCCTTTAACGAGCGAC
CCATTTGGACGCGGCGATCGCTACTGAATTACCTGGGAGGTAAGCTGCGCAACTGGAACGAGCTGAAAAAATACC
TCAACTATACGGCCTACCAATTCAAGGGCGGGCCCTGGAGGGACGGCGTGGTGCAGTACGGTGTCGATCCGAGGA
CAGACGCCAAGTATCGCGTCTACCAGACGCTCATGTTCAAGCTGGCGACCAAGGACTTTAAGGGGCGGACATGGC
AGTCAATGCGAAGATTGCAGGCTATCCTAGGGCGAGAGGCGGGCACCGACGGCAGCCAGAGCCATCTGTTCAACG
GCGAGTCGTACTCTGATGACGGCAAGGTGTGGCAGGTGTGCGACATTACGGACCCGCTGCTCAAGGAGATGCTGG
AGGAGGCAGCGGTGCGGCCGACGTGTGACGTCAACAGTGGCTGGTATCACGGCGGGCTGTGGGCCAAGGTCAAGG
CGGTGATGAAGACGAAGCTGGTGGCGATCCGGTTCGGGCGTCAACTGACGAGGGGGGACTTTGCGGCGACGCTGC
GGTGCGGCGACGAGACGCCGACCAAGGCGACGAGCAATTGGAATCTTCCGCTGCCGAAGCTAAAGCTTACTGACG
AAGAGATGATGGTGCTACGCGGCCGCAGAGTTGCCAAGAAGGAGACGACGTATGCATCGCGAGGGCGTGATCCGC
GGAGGGGACAGAAGGCGTCGGATACGTTGATGGCGTCGAGACCGGCTGGGGATTCGCAGGCGACTGTGAGCGGCA
CTGGGTTGGACGAGGATGGAGGGGAGGGTGAAGTCGAGATCGAGGACGAGGAAGAGGACGAGGAAGAGGACGAGG
AAGAGGACGAGGAAGAGGACGAGGAAGAGGTCGAAGGAGAGGTCGAAGGAGAGGCCGAGAGTGACGACGGTTCGG
GTGAAGATGATGACGACGATGTTGAGTTGGATGAGGGCGAGGACAACGAAGATGATTTGGGCGACGATGAAGGCG
ACGATGAAGACGATGACTTGGGCGAGGAAGACGACAACGAAGACGAGTTTTACGGATACGAATTCAACAACAAGG
CTCAGCACGACGATGAAGAGATGGCCGAAGGCGACTATGGCAACGTTGGCTTGACCAGCGGCCACTACGGCGAAT
ACGGCCTCGATCTAGACGACGATGATGAAGACGACGAAGATGACGATGATATGAACGAGGTTCAACGCCAGATAT
ATCCCGAGCCGCCCGCCTACGGCCTCGACGAGGATGATGCTGGCCAGGACGATGGGTTGGCGAACCGCGCGGTGT
ATCCGGAACTGGACTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail