Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03505
Gene name
Locationscaffold_03:2878913..2880181
Strand+
Gene length (bp)1268
Transcript length (bp)1143
Coding sequence length (bp)1143
Protein length (aa) 381

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04818 CID CID domain 3.3E-23 36 166

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.5468 0.6728 0.2321 0.0495 0.0679 0.0192 0.066 0.0942 0.1391 0.015

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4378
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5403
Ophiocordyceps australis map64 (Brazil) OphauB2|1865
Ophiocordyceps camponoti-floridani Ophcf2|03505 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|5554
Ophiocordyceps kimflemingae Ophio5|7544
Ophiocordyceps subramaniannii Hirsu2|9054

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03505
MVVTPDLAAAKANLTALLLRADPESLSRAAAAEFLELLDNTLDKCSRPNVQKCKNWILANVVPSDERAFALGRYL
VALSESMEKDFDRPSVRRRRLHVLYIASDVLHHAVICRDDQHLSRAWEGHLPAMIATASTFEKYPKHLRKVRALI
DLWEEKRYLYADVILKLRDSFTRASDKESGTRIQMSSAALELAKEAPFLIPSVHGEASVPWNDLPAATWLPQLKP
GSTQLMSRNLVRPVQLKSGVAPQPLVQVVKDTLQEAKTLYVKDHLRDRTSIDFNLMGETQAQPGTRETATYWGWT
PKLCRRVKQGQHCVETLPQNMGPSRSPFKIHIPIRDKPQPHPTPKPKPQPQPPSAPDRPQHRQQLQTTKPSPSRA
QKSLV*
Coding >Ophcf2|03505
ATGGTCGTGACTCCGGACCTGGCCGCTGCCAAAGCCAACCTTACAGCCCTGCTGCTGCGCGCCGATCCTGAATCC
TTGAGTCGGGCAGCGGCAGCCGAATTTCTCGAGCTGCTCGACAATACGCTCGATAAGTGTTCGCGACCCAACGTT
CAGAAATGCAAGAACTGGATCCTCGCCAACGTCGTGCCCTCCGACGAACGAGCCTTTGCGCTGGGGAGATACCTC
GTCGCCCTTTCAGAGAGCATGGAGAAGGACTTCGACCGTCCCAGCGTCCGCCGCCGCCGACTGCACGTTCTCTAC
ATTGCCAGCGACGTGCTGCACCATGCCGTCATCTGCCGCGACGACCAGCACCTCTCTCGCGCCTGGGAAGGCCAT
CTGCCGGCCATGATTGCGACGGCATCTACGTTTGAGAAGTATCCCAAGCACCTTCGCAAGGTCCGCGCCCTCATT
GATCTTTGGGAGGAGAAGCGCTATCTGTACGCGGACGTGATCCTCAAGCTCAGAGACTCCTTCACCCGCGCCTCC
GATAAGGAATCCGGCACCCGAATTCAGATGTCGTCGGCTGCCCTCGAGCTCGCCAAGGAAGCGCCCTTCCTGATT
CCTTCGGTTCACGGCGAAGCTTCCGTGCCGTGGAACGACCTGCCCGCCGCGACTTGGCTTCCACAGCTCAAGCCC
GGCTCGACCCAGCTCATGAGTCGCAATCTCGTGCGGCCCGTCCAGCTCAAATCAGGTGTCGCGCCCCAGCCACTG
GTCCAAGTGGTCAAGGATACTCTCCAAGAAGCCAAAACGCTGTACGTCAAGGATCATCTTCGAGACAGGACAAGC
ATCGACTTCAACCTCATGGGAGAGACTCAAGCCCAGCCCGGCACTCGCGAAACCGCCACCTATTGGGGCTGGACG
CCCAAGCTCTGCCGTCGCGTCAAGCAAGGCCAGCACTGCGTCGAAACACTCCCGCAGAACATGGGGCCGTCCCGC
TCGCCGTTCAAGATACACATCCCGATCCGAGACAAGCCGCAGCCCCATCCGACGCCGAAGCCGAAGCCGCAGCCG
CAGCCCCCCTCGGCGCCGGACCGGCCCCAGCACAGGCAGCAACTTCAGACGACGAAGCCCAGCCCGTCACGAGCG
CAGAAAAGCCTCGTATAG
Transcript >Ophcf2|03505
ATGGTCGTGACTCCGGACCTGGCCGCTGCCAAAGCCAACCTTACAGCCCTGCTGCTGCGCGCCGATCCTGAATCC
TTGAGTCGGGCAGCGGCAGCCGAATTTCTCGAGCTGCTCGACAATACGCTCGATAAGTGTTCGCGACCCAACGTT
CAGAAATGCAAGAACTGGATCCTCGCCAACGTCGTGCCCTCCGACGAACGAGCCTTTGCGCTGGGGAGATACCTC
GTCGCCCTTTCAGAGAGCATGGAGAAGGACTTCGACCGTCCCAGCGTCCGCCGCCGCCGACTGCACGTTCTCTAC
ATTGCCAGCGACGTGCTGCACCATGCCGTCATCTGCCGCGACGACCAGCACCTCTCTCGCGCCTGGGAAGGCCAT
CTGCCGGCCATGATTGCGACGGCATCTACGTTTGAGAAGTATCCCAAGCACCTTCGCAAGGTCCGCGCCCTCATT
GATCTTTGGGAGGAGAAGCGCTATCTGTACGCGGACGTGATCCTCAAGCTCAGAGACTCCTTCACCCGCGCCTCC
GATAAGGAATCCGGCACCCGAATTCAGATGTCGTCGGCTGCCCTCGAGCTCGCCAAGGAAGCGCCCTTCCTGATT
CCTTCGGTTCACGGCGAAGCTTCCGTGCCGTGGAACGACCTGCCCGCCGCGACTTGGCTTCCACAGCTCAAGCCC
GGCTCGACCCAGCTCATGAGTCGCAATCTCGTGCGGCCCGTCCAGCTCAAATCAGGTGTCGCGCCCCAGCCACTG
GTCCAAGTGGTCAAGGATACTCTCCAAGAAGCCAAAACGCTGTACGTCAAGGATCATCTTCGAGACAGGACAAGC
ATCGACTTCAACCTCATGGGAGAGACTCAAGCCCAGCCCGGCACTCGCGAAACCGCCACCTATTGGGGCTGGACG
CCCAAGCTCTGCCGTCGCGTCAAGCAAGGCCAGCACTGCGTCGAAACACTCCCGCAGAACATGGGGCCGTCCCGC
TCGCCGTTCAAGATACACATCCCGATCCGAGACAAGCCGCAGCCCCATCCGACGCCGAAGCCGAAGCCGCAGCCG
CAGCCCCCCTCGGCGCCGGACCGGCCCCAGCACAGGCAGCAACTTCAGACGACGAAGCCCAGCCCGTCACGAGCG
CAGAAAAGCCTCGTATAG
Gene >Ophcf2|03505
ATGGTCGTGACTCCGGACCTGGCCGCTGCCAAAGCCAACCTTACAGCCCTGCTGCTGCGCGCCGATCCTGAATCC
TTGAGTCGGGCAGCGGCAGCCGAATTTCTCGAGCTGCTCGACAATACGCTCGATAAGTGTTCGCGACCCAACGTT
CAGGTAATCTTCCTTTCTGCTTTTTCTGCGCTTCTGTTACTATTGCAGGCTCTTTGGCTAACGTGGAGGCTGGCT
GAACAGAAATGCAAGAACTGGATCCTCGCCAACGTCGTGCCCTCCGACGAACGAGCCTTTGCGCTGGGGAGATAC
CTCGTCGCCCTTTCAGAGAGCATGGAGAAGGACTTCGACCGTCCCAGCGTCCGCCGCCGCCGACTGCACGTTCTC
TACATTGCCAGCGACGTGCTGCACCATGCCGTCATCTGCCGCGACGACCAGCACCTCTCTCGCGCCTGGGAAGGC
CATCTGCCGGCCATGATTGCGACGGCATCTACGTTTGAGAAGTATCCCAAGCACCTTCGCAAGGTCCGCGCCCTC
ATTGATCTTTGGGAGGAGAAGCGCTATCTGTACGCGGACGTGATCCTCAAGCTCAGAGACTCCTTCACCCGCGCC
TCCGATAAGGAATCCGGCACCCGAATTCAGATGTCGTCGGCTGCCCTCGAGCTCGCCAAGGAAGCGCCCTTCCTG
ATTCCTTCGGTTCACGGCGAAGCTTCCGTGCCGTGGAACGACCTGCCCGCCGCGACTTGGCTTCCACAGCTCAAG
CCCGGCTCGACCCAGCTCATGAGTCGCAATCTCGTGCGGCCCGTCCAGCTCAAATCAGGTGTCGCGCCCCAGCCA
CTGGTCCAAGTGGTCAAGGATACTCTCCAAGAAGCCAAAACGCTGTACGTCAAGGATCATCTTCGAGACAGGACA
AGCATCGACTTCAACCTCATGGGAGAGACTCAAGCCCAGCCCGGCACTCGCGAAACCGCCACCTATTGGGGCTGG
ACGCCCAAGCTCTGCCGTCGCGTCAAGCAAGGCCAGCACTGCGTCGAAACACTCCCGCAGAACATGGGGCCGTCC
CGCTCGCGTTCCAAATCAAGAGGCTCATCTCCGCGACGGAGCCGTTCCCCCAAGCGTTCAAGATACACATCCCGA
TCCGAGACAAGCCGCAGCCCCATCCGACGCCGAAGCCGAAGCCGCAGCCGCAGCCCCCCTCGGCGCCGGACCGGC
CCCAGCACAGGCAGCAACTTCAGACGACGAAGCCCAGCCCGTCACGAGCGCAGAAAAGCCTCGTATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail