Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03497
Gene name
Locationscaffold_03:2862288..2864328
Strand-
Gene length (bp)2040
Transcript length (bp)2040
Coding sequence length (bp)2040
Protein length (aa) 680

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.1152 0.0701 0.9075 0.1278 0.2136 0.0186 0.1479 0.2713 0.0583 0.0049

SignalP

SignalP signal predicted Location Score
Yes 1 - 16 0.999629

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup513
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2042
Ophiocordyceps australis 1348a (Ghana) OphauG2|2043
Ophiocordyceps australis map64 (Brazil) OphauB2|330
Ophiocordyceps camponoti-floridani Ophcf2|03497 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|1443
Ophiocordyceps kimflemingae Ophio5|1795
Ophiocordyceps subramaniannii Hirsu2|2153
Ophiocordyceps subramaniannii Hirsu2|2505

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03497
MHLLLPLSLLALGAGAQEPPKNEADEACALVSKAVGEPEPLSPGQENSTKPRRRILPGREAYNCLKSIPFDKDRA
SAFVPELKKYLGFQSTLDLLKKPPKTWPFAPVDIPKGLDALGTDFKNQYQFDLAIDQLMTNAHDAHLRMQTCSLS
IFEFRRDHAGIVSVSKDGLADPEVFAATDVAHLAKGHNDKISPIKTINGEDVLSFLEKIAIDSSAQSPDAQWNEL
FVSPATGSKLKTGQFIGNHGDWPGGDVTTITFKNGSSVEAPTIAFADGTKRFNETTPAQVFDSYCVPKGPPPPRT
LRNGTLPDIPTLPKPFARDPLNEMLGFNLDNETIVLRLPSFGSAEKAQDYSVLIHNLTNSIFRKAKKSGRTKMII
DVSSNSGGHIARYLDLFGALFPDLVPDENRRLRRSEQVTALIQAFSVFNETESRNQNFTFAHKTLTRPDLTTGFP
TVQDFIGNAVLEGQPMTAPFNFISLLESNFTPISGFGERTFDKTKRPKRPFRVDDMVILGNGICHSSCATFVHLM
TTQGGVKTIVFGGRHQPGPMDIIGGVRGGEVAPLHGLSAMMDNAKNILLNSTNTVPLSQSDREKAANSLPKPLQN
LTLALGGAVNLHSMYTTEGDDGLTLQFLKSPANCRRFYTGRNIADPKTVWKDAKEAAWGNGKCLDQVTEEEKTEE
AKAP*
Coding >Ophcf2|03497
ATGCATCTTCTTCTACCTCTTTCGCTTCTCGCCCTGGGTGCCGGCGCCCAGGAACCTCCTAAGAACGAGGCCGAT
GAGGCCTGTGCCCTCGTCAGTAAAGCAGTCGGCGAGCCGGAGCCTCTGAGTCCGGGCCAAGAGAACAGCACAAAA
CCCCGTCGCCGGATCCTCCCAGGCCGGGAGGCCTATAATTGCCTAAAGTCGATTCCTTTCGATAAGGATCGAGCC
TCGGCGTTCGTACCGGAGCTCAAGAAGTATCTGGGGTTCCAGTCGACGCTCGATTTGCTCAAGAAACCCCCAAAG
ACGTGGCCCTTTGCACCCGTCGACATCCCTAAAGGCCTGGATGCTCTCGGGACCGACTTCAAGAACCAATACCAA
TTCGATCTTGCCATCGATCAGCTCATGACGAATGCCCATGATGCTCATCTCCGTATGCAGACCTGCTCGCTGTCC
ATCTTCGAATTCCGGCGAGATCACGCCGGCATCGTCTCCGTATCCAAGGACGGCCTGGCAGATCCCGAGGTCTTC
GCGGCCACTGATGTCGCTCATCTTGCCAAGGGACACAACGACAAGATCTCCCCCATCAAGACCATCAACGGCGAG
GACGTCTTGAGCTTCCTCGAGAAGATCGCCATCGACTCCAGCGCGCAGAGTCCGGATGCCCAGTGGAACGAGCTC
TTCGTCAGCCCGGCGACCGGATCCAAGCTCAAGACCGGACAGTTCATCGGCAACCACGGAGATTGGCCCGGCGGT
GACGTGACGACCATCACTTTCAAAAACGGCTCCTCGGTCGAGGCTCCGACCATTGCCTTTGCCGATGGCACGAAA
CGCTTCAATGAGACGACGCCGGCTCAAGTCTTTGATTCGTACTGCGTGCCGAAGGGTCCTCCGCCACCTCGTACT
CTCAGGAACGGGACGTTGCCCGACATCCCGACGCTTCCCAAGCCCTTTGCGCGCGATCCGCTCAACGAGATGTTG
GGCTTCAACCTCGACAACGAGACCATCGTCTTGAGGTTGCCCTCGTTTGGTAGTGCCGAGAAGGCGCAGGACTAC
TCCGTCCTCATCCACAACCTGACCAACTCCATCTTCAGAAAGGCCAAGAAGTCGGGCCGCACCAAGATGATCATC
GACGTCTCCAGCAACAGCGGCGGCCACATCGCTCGATACCTTGACCTCTTCGGGGCCTTGTTCCCGGATCTTGTC
CCCGATGAGAACCGCCGGCTTCGACGCAGCGAGCAGGTGACGGCCTTGATTCAGGCTTTCTCCGTCTTCAACGAG
ACCGAGTCTAGAAATCAGAACTTTACCTTTGCCCACAAGACGCTCACCAGGCCCGACCTGACGACGGGATTCCCA
ACTGTCCAGGACTTTATCGGCAATGCAGTACTCGAGGGCCAGCCCATGACGGCGCCTTTCAACTTCATTTCCCTG
CTCGAGTCCAACTTTACGCCCATTAGCGGCTTCGGGGAAAGGACCTTTGACAAAACCAAGCGTCCGAAGCGACCT
TTCCGTGTGGATGACATGGTCATCCTCGGCAACGGCATCTGCCACTCCTCCTGCGCCACCTTTGTTCACCTCATG
ACCACGCAGGGCGGCGTCAAGACGATCGTCTTTGGAGGCCGTCATCAGCCCGGGCCCATGGACATCATCGGCGGC
GTTCGCGGCGGCGAGGTAGCACCCTTGCACGGGCTCTCGGCCATGATGGACAACGCAAAGAATATCCTTCTCAAC
TCGACCAACACGGTCCCCCTCAGCCAGTCAGACCGCGAAAAGGCAGCCAACTCGCTGCCCAAGCCGCTGCAGAAC
CTGACGCTGGCACTGGGCGGCGCCGTCAACCTGCACAGCATGTACACGACCGAAGGCGACGACGGTCTGACGCTG
CAGTTCCTGAAGAGCCCTGCCAACTGCCGTCGTTTCTACACGGGGCGTAATATCGCGGACCCCAAGACGGTCTGG
AAGGATGCTAAGGAGGCGGCTTGGGGGAATGGCAAGTGTCTTGACCAGGTGACGGAGGAGGAGAAGACGGAGGAG
GCCAAGGCGCCTTGA
Transcript >Ophcf2|03497
ATGCATCTTCTTCTACCTCTTTCGCTTCTCGCCCTGGGTGCCGGCGCCCAGGAACCTCCTAAGAACGAGGCCGAT
GAGGCCTGTGCCCTCGTCAGTAAAGCAGTCGGCGAGCCGGAGCCTCTGAGTCCGGGCCAAGAGAACAGCACAAAA
CCCCGTCGCCGGATCCTCCCAGGCCGGGAGGCCTATAATTGCCTAAAGTCGATTCCTTTCGATAAGGATCGAGCC
TCGGCGTTCGTACCGGAGCTCAAGAAGTATCTGGGGTTCCAGTCGACGCTCGATTTGCTCAAGAAACCCCCAAAG
ACGTGGCCCTTTGCACCCGTCGACATCCCTAAAGGCCTGGATGCTCTCGGGACCGACTTCAAGAACCAATACCAA
TTCGATCTTGCCATCGATCAGCTCATGACGAATGCCCATGATGCTCATCTCCGTATGCAGACCTGCTCGCTGTCC
ATCTTCGAATTCCGGCGAGATCACGCCGGCATCGTCTCCGTATCCAAGGACGGCCTGGCAGATCCCGAGGTCTTC
GCGGCCACTGATGTCGCTCATCTTGCCAAGGGACACAACGACAAGATCTCCCCCATCAAGACCATCAACGGCGAG
GACGTCTTGAGCTTCCTCGAGAAGATCGCCATCGACTCCAGCGCGCAGAGTCCGGATGCCCAGTGGAACGAGCTC
TTCGTCAGCCCGGCGACCGGATCCAAGCTCAAGACCGGACAGTTCATCGGCAACCACGGAGATTGGCCCGGCGGT
GACGTGACGACCATCACTTTCAAAAACGGCTCCTCGGTCGAGGCTCCGACCATTGCCTTTGCCGATGGCACGAAA
CGCTTCAATGAGACGACGCCGGCTCAAGTCTTTGATTCGTACTGCGTGCCGAAGGGTCCTCCGCCACCTCGTACT
CTCAGGAACGGGACGTTGCCCGACATCCCGACGCTTCCCAAGCCCTTTGCGCGCGATCCGCTCAACGAGATGTTG
GGCTTCAACCTCGACAACGAGACCATCGTCTTGAGGTTGCCCTCGTTTGGTAGTGCCGAGAAGGCGCAGGACTAC
TCCGTCCTCATCCACAACCTGACCAACTCCATCTTCAGAAAGGCCAAGAAGTCGGGCCGCACCAAGATGATCATC
GACGTCTCCAGCAACAGCGGCGGCCACATCGCTCGATACCTTGACCTCTTCGGGGCCTTGTTCCCGGATCTTGTC
CCCGATGAGAACCGCCGGCTTCGACGCAGCGAGCAGGTGACGGCCTTGATTCAGGCTTTCTCCGTCTTCAACGAG
ACCGAGTCTAGAAATCAGAACTTTACCTTTGCCCACAAGACGCTCACCAGGCCCGACCTGACGACGGGATTCCCA
ACTGTCCAGGACTTTATCGGCAATGCAGTACTCGAGGGCCAGCCCATGACGGCGCCTTTCAACTTCATTTCCCTG
CTCGAGTCCAACTTTACGCCCATTAGCGGCTTCGGGGAAAGGACCTTTGACAAAACCAAGCGTCCGAAGCGACCT
TTCCGTGTGGATGACATGGTCATCCTCGGCAACGGCATCTGCCACTCCTCCTGCGCCACCTTTGTTCACCTCATG
ACCACGCAGGGCGGCGTCAAGACGATCGTCTTTGGAGGCCGTCATCAGCCCGGGCCCATGGACATCATCGGCGGC
GTTCGCGGCGGCGAGGTAGCACCCTTGCACGGGCTCTCGGCCATGATGGACAACGCAAAGAATATCCTTCTCAAC
TCGACCAACACGGTCCCCCTCAGCCAGTCAGACCGCGAAAAGGCAGCCAACTCGCTGCCCAAGCCGCTGCAGAAC
CTGACGCTGGCACTGGGCGGCGCCGTCAACCTGCACAGCATGTACACGACCGAAGGCGACGACGGTCTGACGCTG
CAGTTCCTGAAGAGCCCTGCCAACTGCCGTCGTTTCTACACGGGGCGTAATATCGCGGACCCCAAGACGGTCTGG
AAGGATGCTAAGGAGGCGGCTTGGGGGAATGGCAAGTGTCTTGACCAGGTGACGGAGGAGGAGAAGACGGAGGAG
GCCAAGGCGCCTTGA
Gene >Ophcf2|03497
ATGCATCTTCTTCTACCTCTTTCGCTTCTCGCCCTGGGTGCCGGCGCCCAGGAACCTCCTAAGAACGAGGCCGAT
GAGGCCTGTGCCCTCGTCAGTAAAGCAGTCGGCGAGCCGGAGCCTCTGAGTCCGGGCCAAGAGAACAGCACAAAA
CCCCGTCGCCGGATCCTCCCAGGCCGGGAGGCCTATAATTGCCTAAAGTCGATTCCTTTCGATAAGGATCGAGCC
TCGGCGTTCGTACCGGAGCTCAAGAAGTATCTGGGGTTCCAGTCGACGCTCGATTTGCTCAAGAAACCCCCAAAG
ACGTGGCCCTTTGCACCCGTCGACATCCCTAAAGGCCTGGATGCTCTCGGGACCGACTTCAAGAACCAATACCAA
TTCGATCTTGCCATCGATCAGCTCATGACGAATGCCCATGATGCTCATCTCCGTATGCAGACCTGCTCGCTGTCC
ATCTTCGAATTCCGGCGAGATCACGCCGGCATCGTCTCCGTATCCAAGGACGGCCTGGCAGATCCCGAGGTCTTC
GCGGCCACTGATGTCGCTCATCTTGCCAAGGGACACAACGACAAGATCTCCCCCATCAAGACCATCAACGGCGAG
GACGTCTTGAGCTTCCTCGAGAAGATCGCCATCGACTCCAGCGCGCAGAGTCCGGATGCCCAGTGGAACGAGCTC
TTCGTCAGCCCGGCGACCGGATCCAAGCTCAAGACCGGACAGTTCATCGGCAACCACGGAGATTGGCCCGGCGGT
GACGTGACGACCATCACTTTCAAAAACGGCTCCTCGGTCGAGGCTCCGACCATTGCCTTTGCCGATGGCACGAAA
CGCTTCAATGAGACGACGCCGGCTCAAGTCTTTGATTCGTACTGCGTGCCGAAGGGTCCTCCGCCACCTCGTACT
CTCAGGAACGGGACGTTGCCCGACATCCCGACGCTTCCCAAGCCCTTTGCGCGCGATCCGCTCAACGAGATGTTG
GGCTTCAACCTCGACAACGAGACCATCGTCTTGAGGTTGCCCTCGTTTGGTAGTGCCGAGAAGGCGCAGGACTAC
TCCGTCCTCATCCACAACCTGACCAACTCCATCTTCAGAAAGGCCAAGAAGTCGGGCCGCACCAAGATGATCATC
GACGTCTCCAGCAACAGCGGCGGCCACATCGCTCGATACCTTGACCTCTTCGGGGCCTTGTTCCCGGATCTTGTC
CCCGATGAGAACCGCCGGCTTCGACGCAGCGAGCAGGTGACGGCCTTGATTCAGGCTTTCTCCGTCTTCAACGAG
ACCGAGTCTAGAAATCAGAACTTTACCTTTGCCCACAAGACGCTCACCAGGCCCGACCTGACGACGGGATTCCCA
ACTGTCCAGGACTTTATCGGCAATGCAGTACTCGAGGGCCAGCCCATGACGGCGCCTTTCAACTTCATTTCCCTG
CTCGAGTCCAACTTTACGCCCATTAGCGGCTTCGGGGAAAGGACCTTTGACAAAACCAAGCGTCCGAAGCGACCT
TTCCGTGTGGATGACATGGTCATCCTCGGCAACGGCATCTGCCACTCCTCCTGCGCCACCTTTGTTCACCTCATG
ACCACGCAGGGCGGCGTCAAGACGATCGTCTTTGGAGGCCGTCATCAGCCCGGGCCCATGGACATCATCGGCGGC
GTTCGCGGCGGCGAGGTAGCACCCTTGCACGGGCTCTCGGCCATGATGGACAACGCAAAGAATATCCTTCTCAAC
TCGACCAACACGGTCCCCCTCAGCCAGTCAGACCGCGAAAAGGCAGCCAACTCGCTGCCCAAGCCGCTGCAGAAC
CTGACGCTGGCACTGGGCGGCGCCGTCAACCTGCACAGCATGTACACGACCGAAGGCGACGACGGTCTGACGCTG
CAGTTCCTGAAGAGCCCTGCCAACTGCCGTCGTTTCTACACGGGGCGTAATATCGCGGACCCCAAGACGGTCTGG
AAGGATGCTAAGGAGGCGGCTTGGGGGAATGGCAAGTGTCTTGACCAGGTGACGGAGGAGGAGAAGACGGAGGAG
GCCAAGGCGCCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail