Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03495
Gene name
Locationscaffold_03:2859477..2860241
Strand-
Gene length (bp)764
Transcript length (bp)486
Coding sequence length (bp)486
Protein length (aa) 162

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00137 ATP-synt_C ATP synthase subunit C 7.4E-10 17 75
PF00137 ATP-synt_C ATP synthase subunit C 1.9E-16 96 155

GO

GO Term Description Terminal node
GO:1902600 proton transmembrane transport Yes
GO:0015078 proton transmembrane transporter activity Yes
GO:0033177 proton-transporting two-sector ATPase complex, proton-transporting domain Yes
GO:0008324 cation transmembrane transporter activity No
GO:0051234 establishment of localization No
GO:0009987 cellular process No
GO:0022890 inorganic cation transmembrane transporter activity No
GO:0006810 transport No
GO:0022857 transmembrane transporter activity No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0005215 transporter activity No
GO:0098655 cation transmembrane transport No
GO:0034220 ion transmembrane transport No
GO:0032991 protein-containing complex No
GO:0006812 cation transport No
GO:0051179 localization No
GO:0098662 inorganic cation transmembrane transport No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0098660 inorganic ion transmembrane transport No
GO:0015075 ion transmembrane transporter activity No
GO:0098796 membrane protein complex No
GO:0055085 transmembrane transport No
GO:0006811 ion transport No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 33 0.5

Transmembrane Domains

Domain # Start End Length
1 10 32 22
2 53 75 22
3 95 117 22
4 130 152 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 180.81 100.00 261.63
Alive In ants, during behavior modification 297.61 170.70 424.52
Dead In ants, recently dead 210.02 117.75 302.30

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.005733 yes
Alive Dead 0.025870 yes
Dead Fungus 0.484277 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03495
MESELAPKFAPFIGMAGIAAAMVFGSIGAAYGTAKSGIGIAGVGTFRPDLIMKCLIPVVMSGIIAVYSLVISVLI
AQDLSPPGNESYSLFSGFMHLACGTAVGMTGLAAGYCIGVVGDTGVRAYMQQSRIFVGMVLILIFGEVLGLYGLI
VALLLNSRSKG*
Coding >Ophcf2|03495
ATGGAGTCCGAGCTGGCACCCAAGTTTGCGCCCTTTATAGGCATGGCTGGCATTGCGGCCGCCATGGTCTTTGGC
TCCATCGGCGCCGCGTACGGCACTGCCAAGTCTGGTATCGGCATCGCGGGCGTCGGAACCTTTCGCCCGGACCTG
ATCATGAAGTGCCTGATCCCCGTCGTCATGTCTGGCATCATCGCCGTCTACTCGCTCGTCATCTCCGTTCTCATC
GCCCAAGACCTCTCGCCGCCGGGCAACGAAAGCTACTCCCTGTTCTCGGGCTTCATGCACCTCGCGTGTGGCACG
GCCGTCGGCATGACGGGCCTCGCGGCTGGATATTGCATCGGTGTCGTCGGTGACACGGGCGTGCGAGCCTACATG
CAGCAGTCGAGAATCTTTGTGGGAATGGTTCTCATTCTCATCTTTGGCGAGGTTCTGGGTCTCTACGGTCTCATT
GTTGCACTACTTCTCAATTCGCGGAGCAAAGGCTGA
Transcript >Ophcf2|03495
ATGGAGTCCGAGCTGGCACCCAAGTTTGCGCCCTTTATAGGCATGGCTGGCATTGCGGCCGCCATGGTCTTTGGC
TCCATCGGCGCCGCGTACGGCACTGCCAAGTCTGGTATCGGCATCGCGGGCGTCGGAACCTTTCGCCCGGACCTG
ATCATGAAGTGCCTGATCCCCGTCGTCATGTCTGGCATCATCGCCGTCTACTCGCTCGTCATCTCCGTTCTCATC
GCCCAAGACCTCTCGCCGCCGGGCAACGAAAGCTACTCCCTGTTCTCGGGCTTCATGCACCTCGCGTGTGGCACG
GCCGTCGGCATGACGGGCCTCGCGGCTGGATATTGCATCGGTGTCGTCGGTGACACGGGCGTGCGAGCCTACATG
CAGCAGTCGAGAATCTTTGTGGGAATGGTTCTCATTCTCATCTTTGGCGAGGTTCTGGGTCTCTACGGTCTCATT
GTTGCACTACTTCTCAATTCGCGGAGCAAAGGCTGA
Gene >Ophcf2|03495
ATGGAGTCCGAGCTGGCACCCAAGTTTGCGCCCTTTATAGGCATGGTGAGTCGTCTCTGGGATCGCCTGGGAGTG
CTGTGGAACTGATGCGTCGACGCAGGCTGGCATTGCGGCCGCCATGGTCTTTGGCTGTAGGCGAGCCCCCGTCTT
CCCATCTCTGGGGCGAAACGAGAAGATGCTGAACGGCTTGCAGCCATCGGCGCCGCGTACGGCACTGCCAAGTCT
GGTATCGGCATCGCGGGCGTCGGAACCTTTCGCCCGGACCTGATCATGAAGGTAGCGCCACTGTCCATATCCTCC
CGTGCCGTCGGCTCGACTAACTCGGTATCTCTCAGTGCCTGATCCCCGTCGTCATGTCTGGCATCATCGCCGTCT
ACTCGCTCGTCATCTCCGTTCTCATCGCCCAAGACCTCTCGCCGCCGGGCAACGAAAGCTACTCCCTGTTCTCGT
ACGTTCTCCCGAACGCCGCCCAACACGGGTCGCGAGTTGACTCGTTGCAGGGGCTTCATGCACCTCGCGTGTGGC
ACGGCCGTCGGCATGACGGGCCTCGCGGCTGGATATTGCATCGGTGTCGTCGGTGACACGGGCGTGCGAGCCTAC
ATGCAGCAGTCGAGAATCTTTGTGGGAATGGTTCTCATTCTCATCTTTGGCGAGGTTCTGGGTCTCTACGGGTAT
GTCTCGGACGGCGCTATCCCTGTCGATGACTTGGCTGACGATGTAGTCTCATTGTTGCACTACTTCTCAATTCGC
GGAGCAAAGGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail