Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03493
Gene name
Locationscaffold_03:2855689..2857088
Strand-
Gene length (bp)1399
Transcript length (bp)1320
Coding sequence length (bp)1320
Protein length (aa) 440

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08743 Nse4_C Nse4 C-terminal 1.7E-33 333 421
PF15412 Nse4-Nse3_bdg Binding domain of Nse4/EID3 to Nse3-MAGE 7.7E-14 128 181

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.2401 0.9159 0.1383 0.0261 0.0874 0.0011 0.0254 0.0498 0.0175 0.0158

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4352
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4977
Ophiocordyceps australis map64 (Brazil) OphauB2|1945
Ophiocordyceps camponoti-floridani Ophcf2|03493 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|1447
Ophiocordyceps kimflemingae Ophio5|4120
Ophiocordyceps subramaniannii Hirsu2|895

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03493
MPTRVQHQVDDDDDDDDDSPVESQPSPSLAIRRSSLDTNKRKRDDSVDGQSSRRQRYSVPDGIDDVFDPDQPLEE
RRILQRQYRELLREINEKREEYLGSESNGLHETIRKADELAKKLHQTTDAAIDSRLLVSTSDLSYRKALRLAQGS
LSTGIDAEDLVSKCILYMRNASGITDNDAPELSSTQRQRREAPPGTEQQDGDDEGEEIGDDGDMMNWAHLGRFAC
LPFLRRPALSGFLLGPLSVEKKARKLTQRSAPFRPNNLTETRPEVLNVDDLANKENDLTVICGKILQQLQQKQVD
AQETVAELIDDDMDDAQKTSMMHDHGLRSTGGLDLMRFVVNPKSFAQTVENMFYVSFLIRDGRIQVEMDEHDLPS
LAPVDREVDTQATSRHSASKHQAVLSMDMQTWRDIIQAFDLTEPMIQHRREVTKSGPGARGWYS*
Coding >Ophcf2|03493
ATGCCGACACGCGTCCAGCATCAGGTCGACGACGACGACGACGACGACGACGATTCTCCCGTTGAGTCGCAACCT
TCGCCGAGCCTCGCCATCCGTCGCTCGTCGCTGGACACGAACAAGCGGAAGCGTGATGACAGCGTCGATGGACAG
TCCAGTCGCCGTCAGAGATACTCGGTGCCCGACGGCATTGACGACGTCTTCGACCCGGACCAGCCCCTAGAGGAG
CGCCGCATCCTGCAGAGACAATACCGCGAACTGCTACGCGAAATCAACGAAAAGCGCGAAGAATATCTCGGCTCC
GAGTCCAATGGCCTGCACGAGACTATTCGCAAGGCAGACGAACTAGCCAAGAAGCTTCATCAGACGACCGATGCC
GCCATCGACTCCCGCCTGCTCGTCAGCACCAGCGACTTATCGTACCGCAAAGCCCTTCGTCTCGCTCAGGGAAGC
CTCTCGACGGGCATTGACGCCGAAGATCTCGTCTCCAAGTGCATATTGTACATGAGGAACGCCTCTGGCATCACT
GACAATGACGCGCCGGAGCTGTCTAGTACGCAGAGGCAGCGTCGGGAGGCGCCGCCAGGAACGGAACAGCAAGAT
GGCGATGATGAAGGCGAGGAGATTGGAGACGATGGAGATATGATGAACTGGGCGCATCTAGGACGCTTCGCCTGC
CTTCCCTTCTTGCGACGCCCTGCCCTTTCCGGCTTCCTCCTCGGACCGCTGTCAGTGGAGAAGAAGGCGCGCAAA
TTGACACAGCGGAGCGCGCCTTTTCGCCCCAACAACCTGACGGAGACGAGGCCCGAGGTTCTCAACGTCGACGAC
CTTGCCAACAAGGAGAACGACTTGACCGTCATCTGCGGCAAGATCCTACAGCAGCTGCAGCAGAAGCAGGTGGAC
GCTCAGGAGACGGTGGCGGAACTCATCGACGACGACATGGACGACGCCCAAAAGACGAGCATGATGCACGATCAC
GGTCTCCGCAGTACTGGCGGTCTTGACCTCATGCGATTTGTCGTCAATCCCAAGTCTTTTGCCCAGACGGTTGAG
AACATGTTTTACGTTAGCTTTCTCATCCGCGATGGGAGGATACAGGTCGAGATGGATGAGCACGACCTCCCGTCT
CTCGCCCCCGTCGACCGCGAAGTAGACACCCAAGCCACTTCCCGCCACAGCGCGTCCAAGCACCAAGCCGTGCTT
TCCATGGACATGCAAACCTGGCGCGACATAATCCAGGCCTTTGACTTGACGGAGCCCATGATCCAACACCGCCGG
GAAGTAACCAAGTCCGGGCCCGGCGCCCGCGGCTGGTACAGCTGA
Transcript >Ophcf2|03493
ATGCCGACACGCGTCCAGCATCAGGTCGACGACGACGACGACGACGACGACGATTCTCCCGTTGAGTCGCAACCT
TCGCCGAGCCTCGCCATCCGTCGCTCGTCGCTGGACACGAACAAGCGGAAGCGTGATGACAGCGTCGATGGACAG
TCCAGTCGCCGTCAGAGATACTCGGTGCCCGACGGCATTGACGACGTCTTCGACCCGGACCAGCCCCTAGAGGAG
CGCCGCATCCTGCAGAGACAATACCGCGAACTGCTACGCGAAATCAACGAAAAGCGCGAAGAATATCTCGGCTCC
GAGTCCAATGGCCTGCACGAGACTATTCGCAAGGCAGACGAACTAGCCAAGAAGCTTCATCAGACGACCGATGCC
GCCATCGACTCCCGCCTGCTCGTCAGCACCAGCGACTTATCGTACCGCAAAGCCCTTCGTCTCGCTCAGGGAAGC
CTCTCGACGGGCATTGACGCCGAAGATCTCGTCTCCAAGTGCATATTGTACATGAGGAACGCCTCTGGCATCACT
GACAATGACGCGCCGGAGCTGTCTAGTACGCAGAGGCAGCGTCGGGAGGCGCCGCCAGGAACGGAACAGCAAGAT
GGCGATGATGAAGGCGAGGAGATTGGAGACGATGGAGATATGATGAACTGGGCGCATCTAGGACGCTTCGCCTGC
CTTCCCTTCTTGCGACGCCCTGCCCTTTCCGGCTTCCTCCTCGGACCGCTGTCAGTGGAGAAGAAGGCGCGCAAA
TTGACACAGCGGAGCGCGCCTTTTCGCCCCAACAACCTGACGGAGACGAGGCCCGAGGTTCTCAACGTCGACGAC
CTTGCCAACAAGGAGAACGACTTGACCGTCATCTGCGGCAAGATCCTACAGCAGCTGCAGCAGAAGCAGGTGGAC
GCTCAGGAGACGGTGGCGGAACTCATCGACGACGACATGGACGACGCCCAAAAGACGAGCATGATGCACGATCAC
GGTCTCCGCAGTACTGGCGGTCTTGACCTCATGCGATTTGTCGTCAATCCCAAGTCTTTTGCCCAGACGGTTGAG
AACATGTTTTACGTTAGCTTTCTCATCCGCGATGGGAGGATACAGGTCGAGATGGATGAGCACGACCTCCCGTCT
CTCGCCCCCGTCGACCGCGAAGTAGACACCCAAGCCACTTCCCGCCACAGCGCGTCCAAGCACCAAGCCGTGCTT
TCCATGGACATGCAAACCTGGCGCGACATAATCCAGGCCTTTGACTTGACGGAGCCCATGATCCAACACCGCCGG
GAAGTAACCAAGTCCGGGCCCGGCGCCCGCGGCTGGTACAGCTGA
Gene >Ophcf2|03493
ATGCCGACACGCGTCCAGCATCAGGTCGACGACGACGACGACGACGACGACGATTCTCCCGTTGAGTCGCAACCT
TCGCCGAGCCTCGCCATCCGTCGCTCGTCGCTGGACACGAACAAGCGGAAGCGTGATGACAGCGTCGATGGACAG
TCCAGTCGCCGTCAGAGATACTCGGTGCCCGACGGCATTGACGACGTCTTCGACCCGGACCAGCCCCTAGAGGAG
CGCCGCATCCTGCAGAGACAATACCGCGAACTGCTACGCGAAATCAACGAAAAGCGCGAAGAATATCTCGGCTCC
GAGTCCAATGGCCTGCACGAGACTATTCGCAAGGCAGACGAACTAGCCAAGAAGCTTCATCAGACGACCGATGCC
GCCATCGACTCCCGCCTGCTCGTCAGCACCAGCGACTTATCGTACCGCAAAGCCCTTCGTCTCGCTCAGGGAAGC
CTCTCGACGGGCATTGACGCCGAAGATCTCGTCTCCAAGTGCATATTGTACATGAGGAACGCCTCTGGCATCACT
GACAATGACGCGCCGGAGCTGTCTAGTACGCAGAGGCAGCGTCGGGAGGCGCCGCCAGGAACGGAACAGCAAGAT
GGCGATGATGAAGGCGAGGAGATTGGAGACGATGGAGATATGATGAACTGGGCGCATCTAGGACGCTTCGCCTGC
CTTCCCTTCTTGCGACGCCCTGCCCTTTCCGGCTTCCTCCTCGGACCGCTGTCAGTGGAGAAGAAGGCGCGCAAA
TTGACACAGCGGAGCGCGCCTTTTCGCCCCAACAACCTGACGGAGACGAGGCCCGAGGTTCTCAACGTCGACGAC
CTTGCCAACAAGGAGAACGACTTGACCGTCATCTGCGGCAAGATCCTACAGCAGCTGCAGCAGAAGCAGGTGGAC
GCTCAGGAGACGGTGGCGGAACTCATCGACGACGACATGGACGACGCCCAAAAGACGAGCATGATGCACGATCAC
GGTCTCCGCAGTACTGGCGGTCTTGACCTCATGCGATTTGTCGTCAATCCCAAGTCTTTTGCCCAGACGGTTGAG
AACATGTTTTACGTTAGCTTTCTCATCCGCGATGGGAGGATACAGGTCGAGATGGATGAGCACGACCTCCCGTCT
CTCGGTGAGTCTCTTTTCTTTTTTTGTCCTCCAACGTTCTTTCAAATGACCTCGGTTCGACTGACCTGTTTTCTC
CCTTGAAGCCCCCGTCGACCGCGAAGTAGACACCCAAGCCACTTCCCGCCACAGCGCGTCCAAGCACCAAGCCGT
GCTTTCCATGGACATGCAAACCTGGCGCGACATAATCCAGGCCTTTGACTTGACGGAGCCCATGATCCAACACCG
CCGGGAAGTAACCAAGTCCGGGCCCGGCGCCCGCGGCTGGTACAGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail