Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03488
Gene name
Locationscaffold_03:2844335..2845121
Strand-
Gene length (bp)786
Transcript length (bp)786
Coding sequence length (bp)786
Protein length (aa) 262

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.6957 0.2235 0.0728 0.4777 0.1872 0.0454 0.1493 0.1788 0.1495 0.1822

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2056
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5686
Ophiocordyceps australis map64 (Brazil) OphauB2|1066
Ophiocordyceps camponoti-floridani Ophcf2|03488 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|1451
Ophiocordyceps kimflemingae Ophio5|2694
Ophiocordyceps subramaniannii Hirsu2|237

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03488
MPSRVGNSAPSRLALPRFELPALDLGFGRITDGTNIPPPPASPVLKVPTPPQTPPAEKEDPLDVKQDGEKSPASK
QQDEPEGRDKRPRASNGAVHNLATPPNGNAAVLKRSVDEDSTSPVGSGRESSLRRIFGKNMLSYQDAEARSMSVG
TASLKANASRPESRGTTIVADDRRRKRSSAWFRRLRGGDSRRSTLYFDESTQVTVVPIKSPDLSPKVSEEPHPIP
VTPPVPVGPPPPKIPELVHLQKDGGILGSDLFKNIK*
Coding >Ophcf2|03488
ATGCCTTCTCGCGTCGGCAATTCAGCGCCTTCGAGGCTTGCTCTCCCTCGATTTGAGCTGCCGGCTCTCGACCTC
GGCTTCGGACGCATCACAGACGGCACGAACATCCCCCCGCCGCCCGCCTCTCCGGTTCTCAAGGTGCCGACGCCG
CCTCAGACGCCGCCGGCTGAGAAGGAGGATCCCCTCGACGTCAAGCAAGACGGCGAGAAGTCGCCCGCGAGCAAA
CAGCAAGATGAGCCCGAGGGCAGAGACAAAAGACCCCGTGCTTCCAATGGAGCCGTCCATAACCTCGCCACTCCC
CCAAACGGTAATGCCGCCGTGCTCAAGCGCTCCGTCGACGAGGATTCCACGAGCCCCGTTGGATCTGGGCGCGAG
AGCAGCCTCCGCCGGATATTCGGTAAGAACATGCTGAGTTACCAAGATGCAGAGGCCCGCTCTATGTCGGTCGGG
ACTGCTTCCCTCAAGGCCAACGCTTCCCGGCCCGAGAGCCGCGGCACCACCATCGTCGCCGATGACCGAAGGAGG
AAGCGCAGCAGCGCCTGGTTTCGGCGTCTGAGGGGGGGTGACTCTCGCCGCTCCACGCTATACTTCGACGAGAGC
ACTCAGGTGACCGTCGTTCCCATCAAGTCTCCCGACCTGTCCCCCAAGGTGTCCGAGGAACCCCACCCGATTCCC
GTCACTCCTCCCGTGCCCGTCGGCCCCCCGCCTCCGAAAATCCCGGAGCTCGTCCATTTGCAGAAGGACGGTGGC
ATCCTGGGCAGCGACCTGTTCAAGAATATCAAATGA
Transcript >Ophcf2|03488
ATGCCTTCTCGCGTCGGCAATTCAGCGCCTTCGAGGCTTGCTCTCCCTCGATTTGAGCTGCCGGCTCTCGACCTC
GGCTTCGGACGCATCACAGACGGCACGAACATCCCCCCGCCGCCCGCCTCTCCGGTTCTCAAGGTGCCGACGCCG
CCTCAGACGCCGCCGGCTGAGAAGGAGGATCCCCTCGACGTCAAGCAAGACGGCGAGAAGTCGCCCGCGAGCAAA
CAGCAAGATGAGCCCGAGGGCAGAGACAAAAGACCCCGTGCTTCCAATGGAGCCGTCCATAACCTCGCCACTCCC
CCAAACGGTAATGCCGCCGTGCTCAAGCGCTCCGTCGACGAGGATTCCACGAGCCCCGTTGGATCTGGGCGCGAG
AGCAGCCTCCGCCGGATATTCGGTAAGAACATGCTGAGTTACCAAGATGCAGAGGCCCGCTCTATGTCGGTCGGG
ACTGCTTCCCTCAAGGCCAACGCTTCCCGGCCCGAGAGCCGCGGCACCACCATCGTCGCCGATGACCGAAGGAGG
AAGCGCAGCAGCGCCTGGTTTCGGCGTCTGAGGGGGGGTGACTCTCGCCGCTCCACGCTATACTTCGACGAGAGC
ACTCAGGTGACCGTCGTTCCCATCAAGTCTCCCGACCTGTCCCCCAAGGTGTCCGAGGAACCCCACCCGATTCCC
GTCACTCCTCCCGTGCCCGTCGGCCCCCCGCCTCCGAAAATCCCGGAGCTCGTCCATTTGCAGAAGGACGGTGGC
ATCCTGGGCAGCGACCTGTTCAAGAATATCAAATGA
Gene >Ophcf2|03488
ATGCCTTCTCGCGTCGGCAATTCAGCGCCTTCGAGGCTTGCTCTCCCTCGATTTGAGCTGCCGGCTCTCGACCTC
GGCTTCGGACGCATCACAGACGGCACGAACATCCCCCCGCCGCCCGCCTCTCCGGTTCTCAAGGTGCCGACGCCG
CCTCAGACGCCGCCGGCTGAGAAGGAGGATCCCCTCGACGTCAAGCAAGACGGCGAGAAGTCGCCCGCGAGCAAA
CAGCAAGATGAGCCCGAGGGCAGAGACAAAAGACCCCGTGCTTCCAATGGAGCCGTCCATAACCTCGCCACTCCC
CCAAACGGTAATGCCGCCGTGCTCAAGCGCTCCGTCGACGAGGATTCCACGAGCCCCGTTGGATCTGGGCGCGAG
AGCAGCCTCCGCCGGATATTCGGTAAGAACATGCTGAGTTACCAAGATGCAGAGGCCCGCTCTATGTCGGTCGGG
ACTGCTTCCCTCAAGGCCAACGCTTCCCGGCCCGAGAGCCGCGGCACCACCATCGTCGCCGATGACCGAAGGAGG
AAGCGCAGCAGCGCCTGGTTTCGGCGTCTGAGGGGGGGTGACTCTCGCCGCTCCACGCTATACTTCGACGAGAGC
ACTCAGGTGACCGTCGTTCCCATCAAGTCTCCCGACCTGTCCCCCAAGGTGTCCGAGGAACCCCACCCGATTCCC
GTCACTCCTCCCGTGCCCGTCGGCCCCCCGCCTCCGAAAATCCCGGAGCTCGTCCATTTGCAGAAGGACGGTGGC
ATCCTGGGCAGCGACCTGTTCAAGAATATCAAATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail