Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03487
Gene name
Locationscaffold_03:2841893..2843590
Strand+
Gene length (bp)1697
Transcript length (bp)1590
Coding sequence length (bp)1590
Protein length (aa) 530

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00955 HCO3_cotransp HCO3- transporter family 1.0E-33 16 183
PF00955 HCO3_cotransp HCO3- transporter family 7.0E-36 189 450

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0006820 anion transport Yes
GO:0005575 cellular_component No
GO:0051179 localization No
GO:0008150 biological_process No
GO:0031224 intrinsic component of membrane No
GO:0006810 transport No
GO:0006811 ion transport No
GO:0110165 cellular anatomical entity No
GO:0051234 establishment of localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 43 65 22
2 78 100 22
3 120 142 22
4 155 172 17
5 187 209 22
6 222 244 22
7 280 299 19
8 319 341 22
9 374 396 22
10 401 423 22
11 457 479 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 2.81 0.63 5.00
Alive In ants, during behavior modification 0.71 0.00 1.48
Dead In ants, recently dead 1.53 0.20 2.87

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.004221 yes
Alive Dead 0.050315 no
Dead Fungus 0.104095 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03487
MPPGPIPPSQRSLFQPFRLLRSDIHNVAQRWTSDWTELNQQVIASAVYIFFTNLLPGITFASDLFELTGRSWGPI
EVVFSTGLCGIVFALFSAQPLTILGVTGPFSVLAENIYQLCSTRFHINFLAVMAWTLIHAGWMHLILAALNAHDW
TMRYVTHFSADVFSLLNSVIYFHKAALELRRTHDTVSLAAFLYAVIGAVGTCLLAVLLSTANSWRPLLHRYLRLG
LAEYAAAISIVLWIAIPHIGELDSLDHQRLQVRTELRPSDPDRTVFLVPFWRLPIAWIFLAIIPAAIVTVLFFFD
HEISSIICTASRYGVRKPAGFAWDVALLGLTTLLCGVLGLPPANGLLPQAPLHSESLLYHDKDGQPRTYEQRYSA
LIQAALILAFISPPFQRLLGLTQTSVLAGLFMFMGYQSLAVNPILGRVAHLLTPPSELPRLPQNVSWLGVHGFTL
TQIVVTGAVFAMTLTVAAPAFPLVIIALVPVRLTLMGRIWSRETLRFVDGWACRPGKPEDNADPVEVPPDTRPDE
EKGP*
Coding >Ophcf2|03487
ATGCCCCCAGGGCCCATCCCCCCGTCTCAACGCTCACTCTTCCAACCCTTCCGCCTCCTCCGCTCCGACATCCAC
AACGTCGCCCAACGATGGACCTCGGACTGGACGGAGCTGAATCAGCAGGTCATCGCCAGCGCCGTCTACATCTTC
TTCACTAATCTACTTCCCGGCATTACCTTTGCCAGCGATCTGTTCGAGCTGACGGGGCGGTCATGGGGGCCCATC
GAGGTTGTCTTCAGCACGGGGCTTTGCGGCATCGTCTTTGCCCTGTTCTCAGCTCAACCTCTCACCATCCTCGGC
GTCACAGGCCCCTTCTCCGTCCTAGCAGAAAACATCTACCAACTCTGCTCAACCCGCTTCCACATCAACTTCCTC
GCCGTCATGGCCTGGACCCTCATCCACGCCGGCTGGATGCACCTCATCCTCGCCGCCCTCAACGCCCACGACTGG
ACGATGCGCTACGTAACCCACTTCAGCGCCGACGTCTTCTCCCTCCTCAACAGCGTCATCTACTTCCACAAAGCC
GCCCTCGAACTCCGCCGCACCCACGACACCGTCTCTCTCGCCGCCTTTCTCTACGCCGTCATCGGCGCCGTTGGA
ACCTGTCTACTAGCCGTCTTACTGTCAACCGCCAACTCATGGCGTCCACTGCTACACCGCTACCTCCGTCTCGGC
CTGGCCGAGTACGCGGCCGCCATCTCCATCGTCTTGTGGATAGCCATCCCCCACATAGGCGAACTCGACTCCCTC
GACCATCAACGCTTACAGGTCCGCACCGAACTGCGACCCTCAGACCCAGACCGCACCGTCTTCCTCGTCCCCTTC
TGGCGGCTACCCATCGCCTGGATCTTCCTCGCCATCATCCCCGCCGCCATCGTCACCGTCCTCTTCTTCTTCGAC
CACGAAATCAGCAGCATCATCTGCACAGCCTCCCGCTACGGCGTCCGGAAACCAGCCGGCTTTGCCTGGGACGTC
GCCCTCCTCGGCCTCACCACCCTCCTCTGCGGCGTCCTCGGTCTCCCGCCAGCCAACGGCCTGCTGCCCCAGGCG
CCTCTCCACTCCGAGTCCCTCCTGTACCACGACAAGGACGGCCAGCCGCGGACATACGAGCAACGCTACTCGGCT
CTTATCCAGGCGGCCCTCATCCTCGCCTTCATCTCGCCCCCCTTCCAGCGCCTCCTCGGCTTGACCCAGACGTCG
GTCTTAGCCGGCCTCTTCATGTTCATGGGCTATCAATCTCTAGCCGTGAACCCCATCCTCGGGCGCGTCGCTCAC
CTCCTAACGCCGCCCTCGGAGCTACCTCGTCTCCCCCAGAACGTCTCCTGGCTCGGCGTCCACGGCTTCACACTA
ACGCAGATTGTCGTCACCGGTGCCGTCTTCGCCATGACGCTCACCGTCGCCGCTCCGGCCTTTCCCCTGGTCATC
ATCGCCCTGGTTCCCGTCCGGCTAACGCTCATGGGCCGTATATGGAGCCGCGAGACGCTGCGCTTCGTCGATGGC
TGGGCCTGTCGTCCGGGGAAACCCGAAGACAATGCGGATCCGGTTGAGGTTCCACCCGATACCCGGCCCGACGAG
GAAAAAGGGCCGTGA
Transcript >Ophcf2|03487
ATGCCCCCAGGGCCCATCCCCCCGTCTCAACGCTCACTCTTCCAACCCTTCCGCCTCCTCCGCTCCGACATCCAC
AACGTCGCCCAACGATGGACCTCGGACTGGACGGAGCTGAATCAGCAGGTCATCGCCAGCGCCGTCTACATCTTC
TTCACTAATCTACTTCCCGGCATTACCTTTGCCAGCGATCTGTTCGAGCTGACGGGGCGGTCATGGGGGCCCATC
GAGGTTGTCTTCAGCACGGGGCTTTGCGGCATCGTCTTTGCCCTGTTCTCAGCTCAACCTCTCACCATCCTCGGC
GTCACAGGCCCCTTCTCCGTCCTAGCAGAAAACATCTACCAACTCTGCTCAACCCGCTTCCACATCAACTTCCTC
GCCGTCATGGCCTGGACCCTCATCCACGCCGGCTGGATGCACCTCATCCTCGCCGCCCTCAACGCCCACGACTGG
ACGATGCGCTACGTAACCCACTTCAGCGCCGACGTCTTCTCCCTCCTCAACAGCGTCATCTACTTCCACAAAGCC
GCCCTCGAACTCCGCCGCACCCACGACACCGTCTCTCTCGCCGCCTTTCTCTACGCCGTCATCGGCGCCGTTGGA
ACCTGTCTACTAGCCGTCTTACTGTCAACCGCCAACTCATGGCGTCCACTGCTACACCGCTACCTCCGTCTCGGC
CTGGCCGAGTACGCGGCCGCCATCTCCATCGTCTTGTGGATAGCCATCCCCCACATAGGCGAACTCGACTCCCTC
GACCATCAACGCTTACAGGTCCGCACCGAACTGCGACCCTCAGACCCAGACCGCACCGTCTTCCTCGTCCCCTTC
TGGCGGCTACCCATCGCCTGGATCTTCCTCGCCATCATCCCCGCCGCCATCGTCACCGTCCTCTTCTTCTTCGAC
CACGAAATCAGCAGCATCATCTGCACAGCCTCCCGCTACGGCGTCCGGAAACCAGCCGGCTTTGCCTGGGACGTC
GCCCTCCTCGGCCTCACCACCCTCCTCTGCGGCGTCCTCGGTCTCCCGCCAGCCAACGGCCTGCTGCCCCAGGCG
CCTCTCCACTCCGAGTCCCTCCTGTACCACGACAAGGACGGCCAGCCGCGGACATACGAGCAACGCTACTCGGCT
CTTATCCAGGCGGCCCTCATCCTCGCCTTCATCTCGCCCCCCTTCCAGCGCCTCCTCGGCTTGACCCAGACGTCG
GTCTTAGCCGGCCTCTTCATGTTCATGGGCTATCAATCTCTAGCCGTGAACCCCATCCTCGGGCGCGTCGCTCAC
CTCCTAACGCCGCCCTCGGAGCTACCTCGTCTCCCCCAGAACGTCTCCTGGCTCGGCGTCCACGGCTTCACACTA
ACGCAGATTGTCGTCACCGGTGCCGTCTTCGCCATGACGCTCACCGTCGCCGCTCCGGCCTTTCCCCTGGTCATC
ATCGCCCTGGTTCCCGTCCGGCTAACGCTCATGGGCCGTATATGGAGCCGCGAGACGCTGCGCTTCGTCGATGGC
TGGGCCTGTCGTCCGGGGAAACCCGAAGACAATGCGGATCCGGTTGAGGTTCCACCCGATACCCGGCCCGACGAG
GAAAAAGGGCCGTGA
Gene >Ophcf2|03487
ATGCCCCCAGGGCCCATCCCCCCGTCTCAACGCTCACTCTTCCAACCCTTCCGCCTCCTCCGCTCCGACATCCAC
AACGTCGCCCAACGATGGACCTCGGACTGGACGGAGCTGAATCAGCAGGTCATCGCCAGCGCCGTCTACATCTTC
TTCACTAATCTACTTCCCGGCATTACCTTTGCCAGCGATCTGTTCGAGCTGACGGGGCGGTCATGGGGGCCCATC
GAGGTTGTCTTCAGCACGGGGCTTTGCGGCATCGTCTTTGCCCTGTGGGTTTTCCCTTCCCTCGTTTGAGAGTCA
CAGCGTTGACAATCGAGAATACCTAGGTTCTCAGCTCAACCTCTCACCATCCTCGGCGTCACAGGCCCCTTCTCC
GTCCTAGCAGAAAACATCTACCAACTCTGCTCAACCCGCTTCCACGTCCGTCCCCAACCGCAACCCCAACCACAT
CCGCTAACCTCCCAAGCCAGATCAACTTCCTCGCCGTCATGGCCTGGACCCTCATCCACGCCGGCTGGATGCACC
TCATCCTCGCCGCCCTCAACGCCCACGACTGGACGATGCGCTACGTAACCCACTTCAGCGCCGACGTCTTCTCCC
TCCTCAACAGCGTCATCTACTTCCACAAAGCCGCCCTCGAACTCCGCCGCACCCACGACACCGTCTCTCTCGCCG
CCTTTCTCTACGCCGTCATCGGCGCCGTTGGAACCTGTCTACTAGCCGTCTTACTGTCAACCGCCAACTCATGGC
GTCCACTGCTACACCGCTACCTCCGTCTCGGCCTGGCCGAGTACGCGGCCGCCATCTCCATCGTCTTGTGGATAG
CCATCCCCCACATAGGCGAACTCGACTCCCTCGACCATCAACGCTTACAGGTCCGCACCGAACTGCGACCCTCAG
ACCCAGACCGCACCGTCTTCCTCGTCCCCTTCTGGCGGCTACCCATCGCCTGGATCTTCCTCGCCATCATCCCCG
CCGCCATCGTCACCGTCCTCTTCTTCTTCGACCACGAAATCAGCAGCATCATCTGCACAGCCTCCCGCTACGGCG
TCCGGAAACCAGCCGGCTTTGCCTGGGACGTCGCCCTCCTCGGCCTCACCACCCTCCTCTGCGGCGTCCTCGGTC
TCCCGCCAGCCAACGGCCTGCTGCCCCAGGCGCCTCTCCACTCCGAGTCCCTCCTGTACCACGACAAGGACGGCC
AGCCGCGGACATACGAGCAACGCTACTCGGCTCTTATCCAGGCGGCCCTCATCCTCGCCTTCATCTCGCCCCCCT
TCCAGCGCCTCCTCGGCTTGACCCAGACGTCGGTCTTAGCCGGCCTCTTCATGTTCATGGGCTATCAATCTCTAG
CCGTGAACCCCATCCTCGGGCGCGTCGCTCACCTCCTAACGCCGCCCTCGGAGCTACCTCGTCTCCCCCAGAACG
TCTCCTGGCTCGGCGTCCACGGCTTCACACTAACGCAGATTGTCGTCACCGGTGCCGTCTTCGCCATGACGCTCA
CCGTCGCCGCTCCGGCCTTTCCCCTGGTCATCATCGCCCTGGTTCCCGTCCGGCTAACGCTCATGGGCCGTATAT
GGAGCCGCGAGACGCTGCGCTTCGTCGATGGCTGGGCCTGTCGTCCGGGGAAACCCGAAGACAATGCGGATCCGG
TTGAGGTTCCACCCGATACCCGGCCCGACGAGGAAAAAGGGCCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail