Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03487
Gene name
Locationscaffold_03:2841893..2843590
Strand+
Gene length (bp)1697
Transcript length (bp)1590
Coding sequence length (bp)1590
Protein length (aa) 530

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00955 HCO3_cotransp HCO3- transporter family 1.0E-33 16 183
PF00955 HCO3_cotransp HCO3- transporter family 7.0E-36 189 450

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0006820 anion transport Yes
GO:0005575 cellular_component No
GO:0051179 localization No
GO:0008150 biological_process No
GO:0031224 intrinsic component of membrane No
GO:0006810 transport No
GO:0006811 ion transport No
GO:0110165 cellular anatomical entity No
GO:0051234 establishment of localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 43 65 22
2 78 100 22
3 120 142 22
4 155 172 17
5 187 209 22
6 222 244 22
7 280 299 19
8 319 341 22
9 374 396 22
10 401 423 22
11 457 479 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03487
MPPGPIPPSQRSLFQPFRLLRSDIHNVAQRWTSDWTELNQQVIASAVYIFFTNLLPGITFASDLFELTGRSWGPI
EVVFSTGLCGIVFALFSAQPLTILGVTGPFSVLAENIYQLCSTRFHINFLAVMAWTLIHAGWMHLILAALNAHDW
TMRYVTHFSADVFSLLNSVIYFHKAALELRRTHDTVSLAAFLYAVIGAVGTCLLAVLLSTANSWRPLLHRYLRLG
LAEYAAAISIVLWIAIPHIGELDSLDHQRLQVRTELRPSDPDRTVFLVPFWRLPIAWIFLAIIPAAIVTVLFFFD
HEISSIICTASRYGVRKPAGFAWDVALLGLTTLLCGVLGLPPANGLLPQAPLHSESLLYHDKDGQPRTYEQRYSA
LIQAALILAFISPPFQRLLGLTQTSVLAGLFMFMGYQSLAVNPILGRVAHLLTPPSELPRLPQNVSWLGVHGFTL
TQIVVTGAVFAMTLTVAAPAFPLVIIALVPVRLTLMGRIWSRETLRFVDGWACRPGKPEDNADPVEVPPDTRPDE
EKGP*
Coding >Ophcf2|03487
ATGCCCCCAGGGCCCATCCCCCCGTCTCAACGCTCACTCTTCCAACCCTTCCGCCTCCTCCGCTCCGACATCCAC
AACGTCGCCCAACGATGGACCTCGGACTGGACGGAGCTGAATCAGCAGGTCATCGCCAGCGCCGTCTACATCTTC
TTCACTAATCTACTTCCCGGCATTACCTTTGCCAGCGATCTGTTCGAGCTGACGGGGCGGTCATGGGGGCCCATC
GAGGTTGTCTTCAGCACGGGGCTTTGCGGCATCGTCTTTGCCCTGTTCTCAGCTCAACCTCTCACCATCCTCGGC
GTCACAGGCCCCTTCTCCGTCCTAGCAGAAAACATCTACCAACTCTGCTCAACCCGCTTCCACATCAACTTCCTC
GCCGTCATGGCCTGGACCCTCATCCACGCCGGCTGGATGCACCTCATCCTCGCCGCCCTCAACGCCCACGACTGG
ACGATGCGCTACGTAACCCACTTCAGCGCCGACGTCTTCTCCCTCCTCAACAGCGTCATCTACTTCCACAAAGCC
GCCCTCGAACTCCGCCGCACCCACGACACCGTCTCTCTCGCCGCCTTTCTCTACGCCGTCATCGGCGCCGTTGGA
ACCTGTCTACTAGCCGTCTTACTGTCAACCGCCAACTCATGGCGTCCACTGCTACACCGCTACCTCCGTCTCGGC
CTGGCCGAGTACGCGGCCGCCATCTCCATCGTCTTGTGGATAGCCATCCCCCACATAGGCGAACTCGACTCCCTC
GACCATCAACGCTTACAGGTCCGCACCGAACTGCGACCCTCAGACCCAGACCGCACCGTCTTCCTCGTCCCCTTC
TGGCGGCTACCCATCGCCTGGATCTTCCTCGCCATCATCCCCGCCGCCATCGTCACCGTCCTCTTCTTCTTCGAC
CACGAAATCAGCAGCATCATCTGCACAGCCTCCCGCTACGGCGTCCGGAAACCAGCCGGCTTTGCCTGGGACGTC
GCCCTCCTCGGCCTCACCACCCTCCTCTGCGGCGTCCTCGGTCTCCCGCCAGCCAACGGCCTGCTGCCCCAGGCG
CCTCTCCACTCCGAGTCCCTCCTGTACCACGACAAGGACGGCCAGCCGCGGACATACGAGCAACGCTACTCGGCT
CTTATCCAGGCGGCCCTCATCCTCGCCTTCATCTCGCCCCCCTTCCAGCGCCTCCTCGGCTTGACCCAGACGTCG
GTCTTAGCCGGCCTCTTCATGTTCATGGGCTATCAATCTCTAGCCGTGAACCCCATCCTCGGGCGCGTCGCTCAC
CTCCTAACGCCGCCCTCGGAGCTACCTCGTCTCCCCCAGAACGTCTCCTGGCTCGGCGTCCACGGCTTCACACTA
ACGCAGATTGTCGTCACCGGTGCCGTCTTCGCCATGACGCTCACCGTCGCCGCTCCGGCCTTTCCCCTGGTCATC
ATCGCCCTGGTTCCCGTCCGGCTAACGCTCATGGGCCGTATATGGAGCCGCGAGACGCTGCGCTTCGTCGATGGC
TGGGCCTGTCGTCCGGGGAAACCCGAAGACAATGCGGATCCGGTTGAGGTTCCACCCGATACCCGGCCCGACGAG
GAAAAAGGGCCGTGA
Transcript >Ophcf2|03487
ATGCCCCCAGGGCCCATCCCCCCGTCTCAACGCTCACTCTTCCAACCCTTCCGCCTCCTCCGCTCCGACATCCAC
AACGTCGCCCAACGATGGACCTCGGACTGGACGGAGCTGAATCAGCAGGTCATCGCCAGCGCCGTCTACATCTTC
TTCACTAATCTACTTCCCGGCATTACCTTTGCCAGCGATCTGTTCGAGCTGACGGGGCGGTCATGGGGGCCCATC
GAGGTTGTCTTCAGCACGGGGCTTTGCGGCATCGTCTTTGCCCTGTTCTCAGCTCAACCTCTCACCATCCTCGGC
GTCACAGGCCCCTTCTCCGTCCTAGCAGAAAACATCTACCAACTCTGCTCAACCCGCTTCCACATCAACTTCCTC
GCCGTCATGGCCTGGACCCTCATCCACGCCGGCTGGATGCACCTCATCCTCGCCGCCCTCAACGCCCACGACTGG
ACGATGCGCTACGTAACCCACTTCAGCGCCGACGTCTTCTCCCTCCTCAACAGCGTCATCTACTTCCACAAAGCC
GCCCTCGAACTCCGCCGCACCCACGACACCGTCTCTCTCGCCGCCTTTCTCTACGCCGTCATCGGCGCCGTTGGA
ACCTGTCTACTAGCCGTCTTACTGTCAACCGCCAACTCATGGCGTCCACTGCTACACCGCTACCTCCGTCTCGGC
CTGGCCGAGTACGCGGCCGCCATCTCCATCGTCTTGTGGATAGCCATCCCCCACATAGGCGAACTCGACTCCCTC
GACCATCAACGCTTACAGGTCCGCACCGAACTGCGACCCTCAGACCCAGACCGCACCGTCTTCCTCGTCCCCTTC
TGGCGGCTACCCATCGCCTGGATCTTCCTCGCCATCATCCCCGCCGCCATCGTCACCGTCCTCTTCTTCTTCGAC
CACGAAATCAGCAGCATCATCTGCACAGCCTCCCGCTACGGCGTCCGGAAACCAGCCGGCTTTGCCTGGGACGTC
GCCCTCCTCGGCCTCACCACCCTCCTCTGCGGCGTCCTCGGTCTCCCGCCAGCCAACGGCCTGCTGCCCCAGGCG
CCTCTCCACTCCGAGTCCCTCCTGTACCACGACAAGGACGGCCAGCCGCGGACATACGAGCAACGCTACTCGGCT
CTTATCCAGGCGGCCCTCATCCTCGCCTTCATCTCGCCCCCCTTCCAGCGCCTCCTCGGCTTGACCCAGACGTCG
GTCTTAGCCGGCCTCTTCATGTTCATGGGCTATCAATCTCTAGCCGTGAACCCCATCCTCGGGCGCGTCGCTCAC
CTCCTAACGCCGCCCTCGGAGCTACCTCGTCTCCCCCAGAACGTCTCCTGGCTCGGCGTCCACGGCTTCACACTA
ACGCAGATTGTCGTCACCGGTGCCGTCTTCGCCATGACGCTCACCGTCGCCGCTCCGGCCTTTCCCCTGGTCATC
ATCGCCCTGGTTCCCGTCCGGCTAACGCTCATGGGCCGTATATGGAGCCGCGAGACGCTGCGCTTCGTCGATGGC
TGGGCCTGTCGTCCGGGGAAACCCGAAGACAATGCGGATCCGGTTGAGGTTCCACCCGATACCCGGCCCGACGAG
GAAAAAGGGCCGTGA
Gene >Ophcf2|03487
ATGCCCCCAGGGCCCATCCCCCCGTCTCAACGCTCACTCTTCCAACCCTTCCGCCTCCTCCGCTCCGACATCCAC
AACGTCGCCCAACGATGGACCTCGGACTGGACGGAGCTGAATCAGCAGGTCATCGCCAGCGCCGTCTACATCTTC
TTCACTAATCTACTTCCCGGCATTACCTTTGCCAGCGATCTGTTCGAGCTGACGGGGCGGTCATGGGGGCCCATC
GAGGTTGTCTTCAGCACGGGGCTTTGCGGCATCGTCTTTGCCCTGTGGGTTTTCCCTTCCCTCGTTTGAGAGTCA
CAGCGTTGACAATCGAGAATACCTAGGTTCTCAGCTCAACCTCTCACCATCCTCGGCGTCACAGGCCCCTTCTCC
GTCCTAGCAGAAAACATCTACCAACTCTGCTCAACCCGCTTCCACGTCCGTCCCCAACCGCAACCCCAACCACAT
CCGCTAACCTCCCAAGCCAGATCAACTTCCTCGCCGTCATGGCCTGGACCCTCATCCACGCCGGCTGGATGCACC
TCATCCTCGCCGCCCTCAACGCCCACGACTGGACGATGCGCTACGTAACCCACTTCAGCGCCGACGTCTTCTCCC
TCCTCAACAGCGTCATCTACTTCCACAAAGCCGCCCTCGAACTCCGCCGCACCCACGACACCGTCTCTCTCGCCG
CCTTTCTCTACGCCGTCATCGGCGCCGTTGGAACCTGTCTACTAGCCGTCTTACTGTCAACCGCCAACTCATGGC
GTCCACTGCTACACCGCTACCTCCGTCTCGGCCTGGCCGAGTACGCGGCCGCCATCTCCATCGTCTTGTGGATAG
CCATCCCCCACATAGGCGAACTCGACTCCCTCGACCATCAACGCTTACAGGTCCGCACCGAACTGCGACCCTCAG
ACCCAGACCGCACCGTCTTCCTCGTCCCCTTCTGGCGGCTACCCATCGCCTGGATCTTCCTCGCCATCATCCCCG
CCGCCATCGTCACCGTCCTCTTCTTCTTCGACCACGAAATCAGCAGCATCATCTGCACAGCCTCCCGCTACGGCG
TCCGGAAACCAGCCGGCTTTGCCTGGGACGTCGCCCTCCTCGGCCTCACCACCCTCCTCTGCGGCGTCCTCGGTC
TCCCGCCAGCCAACGGCCTGCTGCCCCAGGCGCCTCTCCACTCCGAGTCCCTCCTGTACCACGACAAGGACGGCC
AGCCGCGGACATACGAGCAACGCTACTCGGCTCTTATCCAGGCGGCCCTCATCCTCGCCTTCATCTCGCCCCCCT
TCCAGCGCCTCCTCGGCTTGACCCAGACGTCGGTCTTAGCCGGCCTCTTCATGTTCATGGGCTATCAATCTCTAG
CCGTGAACCCCATCCTCGGGCGCGTCGCTCACCTCCTAACGCCGCCCTCGGAGCTACCTCGTCTCCCCCAGAACG
TCTCCTGGCTCGGCGTCCACGGCTTCACACTAACGCAGATTGTCGTCACCGGTGCCGTCTTCGCCATGACGCTCA
CCGTCGCCGCTCCGGCCTTTCCCCTGGTCATCATCGCCCTGGTTCCCGTCCGGCTAACGCTCATGGGCCGTATAT
GGAGCCGCGAGACGCTGCGCTTCGTCGATGGCTGGGCCTGTCGTCCGGGGAAACCCGAAGACAATGCGGATCCGG
TTGAGGTTCCACCCGATACCCGGCCCGACGAGGAAAAAGGGCCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail