Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03469
Gene name
Locationscaffold_03:2785780..2788257
Strand-
Gene length (bp)2477
Transcript length (bp)2403
Coding sequence length (bp)2403
Protein length (aa) 801

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13639 zf-RING_2 Ring finger domain 9.4E-12 666 710
PF02225 PA PA domain 8.6E-09 200 276
PF13923 zf-C3HC4_2 Zinc finger, C3HC4 type (RING finger) 3.9E-09 666 709
PF12678 zf-rbx1 RING-H2 zinc finger domain 1.1E-08 667 710
PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger) 1.3E-08 667 709
PF17123 zf-RING_11 RING-like zinc finger 1.2E-08 666 695
PF13445 zf-RING_UBOX RING-type zinc-finger 4.7E-05 667 707

GO

GO Term Description Terminal node
GO:0008270 zinc ion binding Yes
GO:0046872 metal ion binding Yes
GO:0043169 cation binding No
GO:0046914 transition metal ion binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 24 0.45

Transmembrane Domains

Domain # Start End Length
1 7 26 19
2 530 552 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03469
MRPPRIAVLALFLAASIFILGRAFTPSSRPHASSSYPSEARSSRSVFGFVYYNTPFSLFPPNAAISLTDDNSTSF
AARPAAFGPKLAALGLSGQLWVGSGFAEDSQDGDGELGCSDLPGWGTGNARAGLRSSFRADMSKPSSSSSSSSSS
SSSAHLLDPDHIVAAKARPARRVDARSSISRRESSSSSSSSSSSSSAHADIQSIQEAAEIQGKVVLLMRGGCGFL
EKVMWAQRRGAIAVIVGDNQKGGPLIQMFAHGDEVENVTVPSVFTARTTAHLLSSLTQPGSFIEDTLDDNGNPVR
KVQQGPKKSEGKTRTLKPATSQPAGSPNPKERRAVRPASSEPAAANRGWLSRLFGWRQAPLVAVDQSRPPSSGRR
DWVLVDSWSDESDKAIRDGLKQSTKPDDKFVIGVHDWRDRHAVDDSAQQVKVPDKTGGSDDSKATSDGASNGPQG
GSITPGSGEYTPARLASRDGKEATAKADGIISRLFGDDKAEIHNKNKAHDANAHHRDFPPHEGLWVTITPTSSAS
PFFDTLLVLVISPLVTLTVVYALLIVRARIRRRRWRAPKSVVDRLPVRTYHTAVSSPSLSPRLPSPSGATPTTPL
LQHSPTRSRPRSRTTTGVLPSENLLVPTPAVPTPAGSAGTGTRPEHEKGAGGFSAEWRKYMGRQVECVVCLEEYV
DGVSRVMSLPCGHEFHADCITPWLTTRRRTCPICKGDVVRTLARGARDGPRYEPYNDGADEDLDAEASGSRAMDG
GSDLERGILSPRPERHSAGRHEGWLGLLSNSFAPRTRQRSQSPQRGVRDR*
Coding >Ophcf2|03469
ATGCGGCCTCCCCGCATCGCCGTTCTCGCCCTCTTCCTGGCCGCCTCCATCTTCATTCTCGGCCGCGCCTTCACT
CCGTCCTCCCGACCTCATGCCTCGTCGTCATATCCCTCCGAGGCCCGCTCCTCTCGCTCCGTCTTCGGCTTCGTC
TACTACAACACGCCCTTCTCGCTCTTCCCTCCCAACGCCGCCATCAGCTTGACCGACGATAACAGCACCTCCTTC
GCCGCCCGTCCCGCCGCCTTTGGGCCCAAGCTCGCCGCCCTCGGCCTGAGCGGCCAGCTGTGGGTTGGCAGCGGC
TTCGCCGAGGATAGTCAGGACGGCGATGGAGAGCTCGGGTGCAGTGACCTTCCTGGCTGGGGGACCGGAAATGCC
CGCGCCGGCCTTCGCAGTTCCTTCCGCGCCGACATGTCCAAGCCGTCTTCGTCTTCGTCATCGTCATCGTCGTCA
TCGTCCTCGGCTCACCTCCTAGATCCGGATCACATCGTTGCCGCAAAGGCTCGTCCAGCCCGCCGTGTCGACGCC
CGATCGTCCATATCGCGACGCGAATCATCCTCCTCTTCTTCCTCCTCCTCCTCCTCCTCCTCCGCCCACGCCGAC
ATCCAGTCCATCCAAGAAGCCGCCGAGATTCAGGGCAAGGTTGTTTTGCTGATGCGCGGCGGCTGCGGCTTCCTG
GAAAAGGTCATGTGGGCTCAGCGTCGAGGTGCCATCGCCGTCATCGTCGGCGATAACCAAAAGGGCGGGCCGCTC
ATCCAGATGTTCGCTCACGGCGATGAGGTCGAGAATGTGACGGTGCCCTCCGTCTTCACCGCTCGCACCACAGCC
CATCTGCTGTCGTCGTTGACGCAGCCGGGTAGCTTCATCGAGGACACGCTCGACGACAACGGTAACCCCGTTCGC
AAGGTCCAGCAGGGCCCCAAAAAGTCCGAAGGCAAGACGCGCACCCTCAAGCCCGCCACCTCCCAGCCCGCCGGT
TCTCCGAATCCTAAGGAAAGGAGGGCCGTCAGGCCGGCGTCGAGCGAACCGGCGGCCGCGAACCGTGGCTGGCTT
TCCAGGCTCTTTGGCTGGCGCCAGGCGCCTCTCGTGGCCGTCGACCAGAGTAGGCCGCCGAGCAGCGGCCGGCGC
GACTGGGTTCTCGTCGACAGCTGGAGCGACGAGTCCGACAAGGCCATCAGGGACGGCCTGAAACAGTCGACCAAG
CCCGACGACAAGTTCGTCATTGGCGTGCACGACTGGCGAGACCGCCATGCCGTCGACGACTCGGCCCAGCAGGTC
AAGGTTCCGGACAAGACCGGCGGCTCTGACGACAGCAAGGCGACGTCTGACGGCGCAAGCAACGGCCCTCAGGGC
GGAAGCATCACCCCGGGTAGCGGCGAGTACACGCCCGCTCGCTTGGCGTCGAGGGACGGCAAAGAAGCGACCGCA
AAGGCCGACGGCATCATCTCGAGACTTTTCGGCGACGACAAGGCCGAGATACACAACAAGAACAAGGCACACGAT
GCCAACGCCCATCACCGCGACTTCCCACCGCACGAGGGCCTCTGGGTCACCATCACTCCGACGAGCAGCGCCAGC
CCCTTCTTCGACACGCTGCTCGTGCTCGTCATCAGCCCGCTGGTGACGCTGACGGTCGTCTACGCCCTCCTCATC
GTCCGCGCCCGTATTCGTCGGAGGAGGTGGAGGGCTCCCAAGTCAGTCGTCGACCGGCTCCCGGTGCGGACGTAC
CACACCGCCGTGTCGTCTCCGAGCCTGTCTCCGAGGCTACCGTCGCCCTCGGGCGCGACACCGACGACGCCTCTG
CTACAACACAGCCCCACACGGTCACGGCCGCGGTCGAGGACCACGACGGGCGTCTTGCCGAGCGAAAACCTGCTG
GTGCCTACGCCCGCCGTCCCGACTCCCGCGGGGTCCGCAGGAACCGGCACCCGACCCGAGCACGAGAAGGGCGCC
GGCGGCTTCTCTGCAGAGTGGAGGAAGTACATGGGAAGGCAGGTCGAGTGCGTCGTGTGCCTGGAGGAGTACGTC
GACGGTGTGAGCAGGGTCATGAGCCTGCCCTGCGGCCACGAGTTCCACGCCGACTGCATAACTCCCTGGTTAACG
ACTCGGCGGCGGACGTGTCCCATCTGCAAGGGGGATGTGGTGCGGACCCTGGCCCGCGGCGCGCGTGACGGTCCT
CGCTACGAGCCCTATAATGACGGTGCCGACGAGGACTTGGACGCCGAGGCCTCGGGGTCTCGCGCCATGGACGGC
GGCTCGGACCTGGAGCGTGGCATCCTCTCGCCCCGGCCAGAACGGCACTCGGCAGGCCGACACGAGGGCTGGCTG
GGATTGCTGTCGAATAGCTTTGCTCCCCGCACGAGACAACGATCGCAGTCGCCTCAACGGGGGGTCCGAGATCGG
TGA
Transcript >Ophcf2|03469
ATGCGGCCTCCCCGCATCGCCGTTCTCGCCCTCTTCCTGGCCGCCTCCATCTTCATTCTCGGCCGCGCCTTCACT
CCGTCCTCCCGACCTCATGCCTCGTCGTCATATCCCTCCGAGGCCCGCTCCTCTCGCTCCGTCTTCGGCTTCGTC
TACTACAACACGCCCTTCTCGCTCTTCCCTCCCAACGCCGCCATCAGCTTGACCGACGATAACAGCACCTCCTTC
GCCGCCCGTCCCGCCGCCTTTGGGCCCAAGCTCGCCGCCCTCGGCCTGAGCGGCCAGCTGTGGGTTGGCAGCGGC
TTCGCCGAGGATAGTCAGGACGGCGATGGAGAGCTCGGGTGCAGTGACCTTCCTGGCTGGGGGACCGGAAATGCC
CGCGCCGGCCTTCGCAGTTCCTTCCGCGCCGACATGTCCAAGCCGTCTTCGTCTTCGTCATCGTCATCGTCGTCA
TCGTCCTCGGCTCACCTCCTAGATCCGGATCACATCGTTGCCGCAAAGGCTCGTCCAGCCCGCCGTGTCGACGCC
CGATCGTCCATATCGCGACGCGAATCATCCTCCTCTTCTTCCTCCTCCTCCTCCTCCTCCTCCGCCCACGCCGAC
ATCCAGTCCATCCAAGAAGCCGCCGAGATTCAGGGCAAGGTTGTTTTGCTGATGCGCGGCGGCTGCGGCTTCCTG
GAAAAGGTCATGTGGGCTCAGCGTCGAGGTGCCATCGCCGTCATCGTCGGCGATAACCAAAAGGGCGGGCCGCTC
ATCCAGATGTTCGCTCACGGCGATGAGGTCGAGAATGTGACGGTGCCCTCCGTCTTCACCGCTCGCACCACAGCC
CATCTGCTGTCGTCGTTGACGCAGCCGGGTAGCTTCATCGAGGACACGCTCGACGACAACGGTAACCCCGTTCGC
AAGGTCCAGCAGGGCCCCAAAAAGTCCGAAGGCAAGACGCGCACCCTCAAGCCCGCCACCTCCCAGCCCGCCGGT
TCTCCGAATCCTAAGGAAAGGAGGGCCGTCAGGCCGGCGTCGAGCGAACCGGCGGCCGCGAACCGTGGCTGGCTT
TCCAGGCTCTTTGGCTGGCGCCAGGCGCCTCTCGTGGCCGTCGACCAGAGTAGGCCGCCGAGCAGCGGCCGGCGC
GACTGGGTTCTCGTCGACAGCTGGAGCGACGAGTCCGACAAGGCCATCAGGGACGGCCTGAAACAGTCGACCAAG
CCCGACGACAAGTTCGTCATTGGCGTGCACGACTGGCGAGACCGCCATGCCGTCGACGACTCGGCCCAGCAGGTC
AAGGTTCCGGACAAGACCGGCGGCTCTGACGACAGCAAGGCGACGTCTGACGGCGCAAGCAACGGCCCTCAGGGC
GGAAGCATCACCCCGGGTAGCGGCGAGTACACGCCCGCTCGCTTGGCGTCGAGGGACGGCAAAGAAGCGACCGCA
AAGGCCGACGGCATCATCTCGAGACTTTTCGGCGACGACAAGGCCGAGATACACAACAAGAACAAGGCACACGAT
GCCAACGCCCATCACCGCGACTTCCCACCGCACGAGGGCCTCTGGGTCACCATCACTCCGACGAGCAGCGCCAGC
CCCTTCTTCGACACGCTGCTCGTGCTCGTCATCAGCCCGCTGGTGACGCTGACGGTCGTCTACGCCCTCCTCATC
GTCCGCGCCCGTATTCGTCGGAGGAGGTGGAGGGCTCCCAAGTCAGTCGTCGACCGGCTCCCGGTGCGGACGTAC
CACACCGCCGTGTCGTCTCCGAGCCTGTCTCCGAGGCTACCGTCGCCCTCGGGCGCGACACCGACGACGCCTCTG
CTACAACACAGCCCCACACGGTCACGGCCGCGGTCGAGGACCACGACGGGCGTCTTGCCGAGCGAAAACCTGCTG
GTGCCTACGCCCGCCGTCCCGACTCCCGCGGGGTCCGCAGGAACCGGCACCCGACCCGAGCACGAGAAGGGCGCC
GGCGGCTTCTCTGCAGAGTGGAGGAAGTACATGGGAAGGCAGGTCGAGTGCGTCGTGTGCCTGGAGGAGTACGTC
GACGGTGTGAGCAGGGTCATGAGCCTGCCCTGCGGCCACGAGTTCCACGCCGACTGCATAACTCCCTGGTTAACG
ACTCGGCGGCGGACGTGTCCCATCTGCAAGGGGGATGTGGTGCGGACCCTGGCCCGCGGCGCGCGTGACGGTCCT
CGCTACGAGCCCTATAATGACGGTGCCGACGAGGACTTGGACGCCGAGGCCTCGGGGTCTCGCGCCATGGACGGC
GGCTCGGACCTGGAGCGTGGCATCCTCTCGCCCCGGCCAGAACGGCACTCGGCAGGCCGACACGAGGGCTGGCTG
GGATTGCTGTCGAATAGCTTTGCTCCCCGCACGAGACAACGATCGCAGTCGCCTCAACGGGGGGTCCGAGATCGG
TGA
Gene >Ophcf2|03469
ATGCGGCCTCCCCGCATCGCCGTTCTCGCCCTCTTCCTGGCCGCCTCCATCTTCATTCTCGGCCGCGCCTTCACT
CCGTCCTCCCGACCTCATGCCTCGTCGTCATATCCCTCCGAGGCCCGCTCCTCTCGCTCCGTCTTCGGCTTCGTC
TACTACAACACGCCCTTCTCGCTCTTCCCTCCCAACGCCGCCATCAGCTTGACCGACGATAACAGCACCTCCTTC
GCCGCCCGTCCCGCCGCCTTTGGGCCCAAGCTCGCCGCCCTCGGCCTGAGCGGCCAGCTGTGGGTTGGCAGCGGC
TTCGCCGAGGATAGTCAGGACGGCGATGGAGAGCTCGGGTGCAGTGACCTTCCTGGCTGGGGGACCGGAAATGCC
CGCGCCGGCCTTCGCAGTTCCTTCCGCGCCGACATGTCCAAGCCGTCTTCGTCTTCGTCATCGTCATCGTCGTCA
TCGTCCTCGGCTCACCTCCTAGATCCGGATCACATCGTTGCCGCAAAGGCTCGTCCAGCCCGCCGTGTCGACGCC
CGATCGTCCATATCGCGACGCGAATCATCCTCCTCTTCTTCCTCCTCCTCCTCCTCCTCCTCCGCCCACGCCGAC
ATCCAGTCCATCCAAGAAGCCGCCGAGATTCAGGGCAAGGTTGTTTTGCTGATGCGCGGCGGCTGCGGCTTCCTG
GAAAAGGTCATGTGGGCTCAGCGTCGAGGTGCCATCGCCGTCATCGTCGGCGATAACCAAAAGGGCGGGCCGCTC
ATCCAGATGTTCGCTCACGGCGATGAGGTCGAGAATGTGACGGTGCCCTCCGTCTTCACCGCTCGCACCACAGCC
CATCTGCTGTCGTCGTTGACGCAGCCGGGTAGCTTCATCGAGGACACGCTCGACGACAACGGTAACCCCGTTCGC
AAGGTCCAGCAGGGCCCCAAAAAGTCCGAAGGCAAGACGCGCACCCTCAAGCCCGCCACCTCCCAGCCCGCCGGT
TCTCCGAATCCTAAGGAAAGGAGGGCCGTCAGGCCGGCGTCGAGCGAACCGGCGGCCGCGAACCGTGGCTGGCTT
TCCAGGCTCTTTGGCTGGCGCCAGGCGCCTCTCGTGGCCGTCGACCAGAGTAGGCCGCCGAGCAGCGGCCGGCGC
GACTGGGTTCTCGTCGACAGCTGGAGCGACGAGTCCGACAAGGCCATCAGGGACGGCCTGAAACAGTCGACCAAG
CCCGACGACAAGTTCGTCATTGGCGTGCACGACTGGCGAGACCGCCATGCCGTCGACGACTCGGCCCAGCAGGTC
AAGGTTCCGGACAAGACCGGCGGCTCTGACGACAGCAAGGCGACGTCTGACGGCGCAAGCAACGGCCCTCAGGGC
GGAAGCATCACCCCGGGTAGCGGCGAGTACACGCCCGCTCGCTTGGCGTCGAGGGACGGCAAAGAAGCGACCGCA
AAGGCCGACGGCATCATCTCGAGACTTTTCGGCGACGACAAGGCCGAGATACACAACAAGAACAAGGCACACGAT
GCCAACGCCCATCACCGCGACTTCCCACCGCACGAGGGCCTCTGGGTCACCATCACTCCGACGAGCAGCGCCAGC
CCCTTCTTCGACACGCTGCTCGTGCTCGTCATCAGCCCGCTGGTGACGCTGACGGTCGTCTACGCCCTCCTCATC
GTCCGCGCCCGTATTCGTCGGAGGAGGTGGAGGGCTCCCAAGTCAGTCGTCGACCGGCTCCCGGTGCGGACGTAC
CACACCGCCGTGTCGTCTCCGAGCCTGTCTCCGAGGCTACCGTCGCCCTCGGGCGCGACACCGACGACGCCTCTG
CTACAACACAGCCCCACACGGTCACGGCCGCGGTCGAGGACCACGACGGGCGTCTTGCCGAGCGAAAACCTGCTG
GTGCCTACGCCCGCCGTCCCGACTCCCGCGGGGTCCGCAGGAACCGGCACCCGACCCGAGCACGAGAAGGGCGCC
GGCGGCTTCTCTGCAGAGTGGAGGAAGTACATGGGAAGGCAGGTCGAGTGCGTCGTGTGCCTGGAGGAGTACGTC
GACGGTGTGAGCAGGGTCATGAGCCTGCCCTGCGGCCACGAGTTCCACGCCGACTGCATGTGAGTCAGCCCCTTG
CGCCAGTCTCGCATCCCGTGTCGACTCGGTCTCGTTACTAACAGGACTCGCAACGCAGAACTCCCTGGTTAACGA
CTCGGCGGCGGACGTGTCCCATCTGCAAGGGGGATGTGGTGCGGACCCTGGCCCGCGGCGCGCGTGACGGTCCTC
GCTACGAGCCCTATAATGACGGTGCCGACGAGGACTTGGACGCCGAGGCCTCGGGGTCTCGCGCCATGGACGGCG
GCTCGGACCTGGAGCGTGGCATCCTCTCGCCCCGGCCAGAACGGCACTCGGCAGGCCGACACGAGGGCTGGCTGG
GATTGCTGTCGAATAGCTTTGCTCCCCGCACGAGACAACGATCGCAGTCGCCTCAACGGGGGGTCCGAGATCGGT
GA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail