Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03468
Gene name
Locationscaffold_03:2783895..2785242
Strand+
Gene length (bp)1347
Transcript length (bp)1098
Coding sequence length (bp)1098
Protein length (aa) 366

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02774 Semialdhyde_dhC Semialdehyde dehydrogenase, dimerisation domain 4.2E-34 166 345
PF01118 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain 2.7E-26 11 133

GO

GO Term Description Terminal node
GO:0008652 cellular amino acid biosynthetic process Yes
GO:0016620 oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor Yes
GO:0046983 protein dimerization activity Yes
GO:0051287 NAD binding Yes
GO:0008152 metabolic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0016491 oxidoreductase activity No
GO:1901576 organic substance biosynthetic process No
GO:0009058 biosynthetic process No
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No
GO:0097159 organic cyclic compound binding No
GO:1901564 organonitrogen compound metabolic process No
GO:0019752 carboxylic acid metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0009987 cellular process No
GO:0043436 oxoacid metabolic process No
GO:0044237 cellular metabolic process No
GO:0016053 organic acid biosynthetic process No
GO:0006520 cellular amino acid metabolic process No
GO:0003824 catalytic activity No
GO:0044283 small molecule biosynthetic process No
GO:0044281 small molecule metabolic process No
GO:0044238 primary metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:0000166 nucleotide binding No
GO:0005515 protein binding No
GO:0036094 small molecule binding No
GO:0044249 cellular biosynthetic process No
GO:0046394 carboxylic acid biosynthetic process No
GO:0006082 organic acid metabolic process No
GO:0008150 biological_process No
GO:0016903 oxidoreductase activity, acting on the aldehyde or oxo group of donors No
GO:0071704 organic substance metabolic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.5983 0.4195 0.0994 0.1032 0.3733 0.1844 0.1662 0.1364 0.1421 0.0151

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1869
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7198
Ophiocordyceps australis map64 (Brazil) OphauB2|4173
Ophiocordyceps camponoti-floridani Ophcf2|03468 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|2776
Ophiocordyceps kimflemingae Ophio5|2324
Ophiocordyceps subramaniannii Hirsu2|1904

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03468
MTTSTPIPPKKCGILGCTGSVGQRFILLLSHHPFLRLHALGASSRSAGRRYRQAVRWKQAVPMGDDVGDMVVREC
KAAEFADCDVVFSGLDAEVAGEIEEAFLRSNLPIFSNAKNHRRNPQVPLIVPTVNITHLPLVTHQRTCRSLTRGL
LVCNSNCAVVGIVLPLAALQASFGPVSTVSVVTLQALSGAGYPGVPAADLIDNVVPFIPGEEDKLETEARKILGS
LAEDGREILHQEGLRISATCNRVPVQDGHTACVSLTFERRPPPNAAACRDALRRYEADVQTMGCPSAPVPPMVVL
DDEDRPQPRLDRDLGAGYAVSVGRVRDDESGVFDIKFTALSHNTVIGAAGSSILNAEAAILKGFI*
Coding >Ophcf2|03468
ATGACGACCTCAACGCCCATCCCCCCTAAGAAATGCGGAATCCTAGGCTGCACCGGCTCCGTCGGCCAACGCTTC
ATCCTCCTCCTCTCCCACCACCCCTTCCTCCGCCTCCACGCCCTCGGCGCATCCTCCCGATCGGCAGGGAGACGA
TACCGCCAAGCCGTGCGATGGAAGCAGGCTGTTCCCATGGGCGATGACGTGGGCGACATGGTGGTTCGGGAGTGT
AAGGCGGCCGAGTTTGCCGACTGCGATGTTGTCTTTAGCGGGTTGGATGCTGAGGTTGCGGGGGAGATTGAGGAG
GCCTTCCTCCGCTCCAACCTCCCCATCTTCTCCAACGCCAAGAACCACCGTCGAAACCCCCAAGTCCCCCTCATA
GTCCCAACCGTCAACATAACCCACCTCCCCCTCGTAACCCACCAGCGCACATGCCGCTCCCTGACCCGCGGCCTT
CTAGTCTGCAACTCCAACTGCGCCGTCGTCGGCATCGTCCTCCCCCTCGCCGCCCTGCAAGCCTCCTTCGGTCCC
GTCTCAACCGTCAGCGTCGTCACCCTCCAGGCCCTCTCCGGCGCGGGCTACCCCGGCGTCCCCGCTGCCGATCTC
ATCGATAACGTCGTGCCGTTTATTCCCGGCGAGGAGGATAAGCTCGAGACGGAGGCGCGCAAGATCCTCGGCTCT
CTTGCCGAGGACGGGCGCGAGATCCTTCATCAGGAGGGTTTGCGTATCTCGGCGACCTGTAATCGTGTTCCCGTC
CAGGACGGTCATACGGCCTGCGTCTCCCTCACCTTCGAAAGACGCCCCCCCCCCAACGCAGCAGCCTGTCGAGAC
GCCCTCCGCCGATACGAAGCCGACGTCCAGACAATGGGATGTCCGTCAGCGCCGGTGCCGCCCATGGTGGTACTG
GATGACGAGGACCGGCCTCAACCCCGGCTCGATCGCGATCTCGGCGCCGGTTACGCCGTCAGCGTCGGCCGCGTC
CGTGATGACGAGAGCGGCGTCTTTGACATCAAGTTTACCGCCTTGAGCCACAACACCGTCATCGGCGCCGCCGGC
TCTTCCATTCTCAACGCCGAAGCCGCCATCCTCAAAGGCTTCATCTAG
Transcript >Ophcf2|03468
ATGACGACCTCAACGCCCATCCCCCCTAAGAAATGCGGAATCCTAGGCTGCACCGGCTCCGTCGGCCAACGCTTC
ATCCTCCTCCTCTCCCACCACCCCTTCCTCCGCCTCCACGCCCTCGGCGCATCCTCCCGATCGGCAGGGAGACGA
TACCGCCAAGCCGTGCGATGGAAGCAGGCTGTTCCCATGGGCGATGACGTGGGCGACATGGTGGTTCGGGAGTGT
AAGGCGGCCGAGTTTGCCGACTGCGATGTTGTCTTTAGCGGGTTGGATGCTGAGGTTGCGGGGGAGATTGAGGAG
GCCTTCCTCCGCTCCAACCTCCCCATCTTCTCCAACGCCAAGAACCACCGTCGAAACCCCCAAGTCCCCCTCATA
GTCCCAACCGTCAACATAACCCACCTCCCCCTCGTAACCCACCAGCGCACATGCCGCTCCCTGACCCGCGGCCTT
CTAGTCTGCAACTCCAACTGCGCCGTCGTCGGCATCGTCCTCCCCCTCGCCGCCCTGCAAGCCTCCTTCGGTCCC
GTCTCAACCGTCAGCGTCGTCACCCTCCAGGCCCTCTCCGGCGCGGGCTACCCCGGCGTCCCCGCTGCCGATCTC
ATCGATAACGTCGTGCCGTTTATTCCCGGCGAGGAGGATAAGCTCGAGACGGAGGCGCGCAAGATCCTCGGCTCT
CTTGCCGAGGACGGGCGCGAGATCCTTCATCAGGAGGGTTTGCGTATCTCGGCGACCTGTAATCGTGTTCCCGTC
CAGGACGGTCATACGGCCTGCGTCTCCCTCACCTTCGAAAGACGCCCCCCCCCCAACGCAGCAGCCTGTCGAGAC
GCCCTCCGCCGATACGAAGCCGACGTCCAGACAATGGGATGTCCGTCAGCGCCGGTGCCGCCCATGGTGGTACTG
GATGACGAGGACCGGCCTCAACCCCGGCTCGATCGCGATCTCGGCGCCGGTTACGCCGTCAGCGTCGGCCGCGTC
CGTGATGACGAGAGCGGCGTCTTTGACATCAAGTTTACCGCCTTGAGCCACAACACCGTCATCGGCGCCGCCGGC
TCTTCCATTCTCAACGCCGAAGCCGCCATCCTCAAAGGCTTCATCTAG
Gene >Ophcf2|03468
ATGACGACCTCAACGCCCATCCCCCCTAAGAAATGCGGCAAGCAACCCCCCTCCTCCCCATCCCCCAAACCCACA
CAACTAACCCCCCCCCCGAAAAGGAATCCTAGGCTGCACCGGCTCCGTCGGCCAACGCTTCATCCTCCTCCTCTC
CCACCACCCCTTCCTCCGCCTCCACGCCCTCGGCGCATCCTCCCGATCGGCAGGGAGACGATACCGCCAAGCCGT
GCGATGGAAGCAGGCTGTTCCCATGGGCGATGACGTGGGCGACATGGTGGTTCGGGAGTGTAAGGCGGCCGAGTT
TGCCGACTGCGATGTTGTCTTTAGCGGGTTGGATGCTGAGGTTGCGGGGGAGATTGGTGAGTTGTTGTCGTCAAC
TTGATGCTCTTCTTCTTTTTTTTTTTTTTTGTTTTATCCTTTCTCACTCAATCTTGGCTAATGAGATTCACTCGG
AATTGCCAGAGGAGGCCTTCCTCCGCTCCAACCTCCCCATCTTCTCCAACGCCAAGAACCACCGTCGAAACCCCC
AAGTCCCCCTCATAGTCCCAACCGTCAACATAACCCACCTCCCCCTCGTAACCCACCAGCGCACATGCCGCTCCC
TGACCCGCGGCCTTCTAGTCTGCAACTCCAACTGCGCCGTCGTCGGCATCGTCCTCCCCCTCGCCGCCCTGCAAG
CCTCCTTCGGTCCCGTCTCAACCGTCAGCGTCGTCACCCTCCAGGCCCTCTCCGGCGCGGGCTACCCCGGCGTCC
CCGCTGCCGATCTCATCGATAACGTCGTGCCGTTTATTCCCGGCGAGGAGGATAAGCTCGAGACGGAGGCGCGCA
AGATCCTCGGCTCTCTTGCCGAGGACGGGCGCGAGATCCTTCATCAGGAGGGTTTGCGTATCTCGGCGACCTGTA
ATCGTGTTCCCGTCCAGGACGGTCATACGGCCTGCGTCTCCCTCACCTTCGAAAGACGCCCCCCCCCCAACGCAG
CAGCCTGTCGAGACGCCCTCCGCCGATACGAAGCCGACGTCCAGACAATGGGATGTCCGTCAGCGCCGGTGCCGC
CCATGGTGGTACTGGATGACGAGGACCGGCCTCAACCCCGGCTCGATCGCGATCTCGGCGCCGGTTACGCCGTCA
GCGTCGGCCGCGTCCGTGATGACGAGAGCGGCGTCTTTGACATCAAGTTTACCGCCTTGAGCCACAACAGTTGGT
CGACCCCCTCCTCGTCTTCCATCACATCATCCCGTCATCCATCCGTCAACGTTCGTTCCTTACTGACTCCGTCAC
ACAGCCGTCATCGGCGCCGCCGGCTCTTCCATTCTCAACGCCGAAGCCGCCATCCTCAAAGGCTTCATCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail