Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03467
Gene name
Locationscaffold_03:2782469..2783605
Strand+
Gene length (bp)1136
Transcript length (bp)909
Coding sequence length (bp)909
Protein length (aa) 303

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04193 PQ-loop PQ loop repeat 1.9E-17 10 68
PF04193 PQ-loop PQ loop repeat 1.4E-20 204 260

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 33 0.5

Transmembrane Domains

Domain # Start End Length
1 10 32 22
2 45 67 22
3 72 94 22
4 162 184 22
5 199 221 22
6 234 256 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 60.44 32.63 88.26
Alive In ants, during behavior modification 131.94 72.63 191.25
Dead In ants, recently dead 95.90 54.05 137.75

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.000238 yes
Alive Dead 0.047142 yes
Dead Fungus 0.014140 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03467
MASSALTDALSGIFGSISLTAWIFLLLPQLYANFKAKSADGLSLVFLFVWSLGDIANLSGALLTNLAPSAVALAG
YFCILDLTLISQCLYYNALNAQLSRSNDSDVDADPEHSPLLADGRERSADLGIVVADSPAPSSQKRAASAADSNA
STGSWTRNGLSLLGVYLIGLAGWFVSYKAGAWGHTPPNAPDLPPPKHDMGATVGVVLGYVSAAFYLCARIPQIVK
NYREKSCQGLSLLFFMLSLTGNLTYGLSLIAYSQESDYLVKSLPWLLGSLGTMVEDGAIFVQFRLYASGSRVEDP
DL*
Coding >Ophcf2|03467
ATGGCCTCGTCCGCTCTAACCGACGCCTTGTCCGGCATCTTTGGCAGCATCAGCCTGACCGCTTGGATTTTCCTG
CTGCTGCCTCAACTGTATGCCAATTTCAAGGCAAAGAGCGCGGATGGACTGAGCCTGGTCTTCCTCTTCGTCTGG
TCGCTGGGCGACATCGCCAATCTCTCAGGCGCTCTGCTCACTAATCTGGCGCCCAGCGCCGTCGCCCTCGCCGGG
TACTTTTGCATCCTGGACCTCACTCTCATCAGCCAATGTCTCTACTACAACGCTCTCAACGCCCAGCTTTCCCGC
TCGAATGACTCGGATGTCGACGCCGACCCGGAACATTCCCCCCTGTTGGCGGACGGTCGCGAACGCTCAGCTGAC
TTGGGCATCGTCGTCGCCGATTCGCCAGCGCCATCGAGTCAGAAACGAGCCGCCTCCGCCGCTGACTCGAACGCC
AGCACCGGCTCGTGGACTCGCAATGGCCTGAGCCTGCTGGGCGTTTACCTGATCGGCCTGGCCGGCTGGTTCGTC
TCGTACAAGGCGGGTGCCTGGGGTCACACCCCGCCAAACGCCCCTGATCTCCCTCCGCCGAAGCACGACATGGGC
GCGACCGTCGGCGTCGTCTTGGGATACGTCAGTGCCGCCTTTTACCTCTGCGCTCGGATCCCGCAGATTGTCAAG
AATTACCGAGAAAAATCATGTCAAGGCTTGTCATTGCTGTTCTTCATGCTGTCTCTGACGGGCAACCTGACATAC
GGCCTGAGTCTGATTGCCTACTCGCAGGAGTCGGATTACCTGGTCAAGTCGCTGCCCTGGCTGCTGGGCTCGCTG
GGCACCATGGTAGAGGACGGGGCGATTTTCGTCCAGTTTCGGCTTTACGCCAGCGGGAGTCGAGTTGAAGACCCG
GACCTTTAG
Transcript >Ophcf2|03467
ATGGCCTCGTCCGCTCTAACCGACGCCTTGTCCGGCATCTTTGGCAGCATCAGCCTGACCGCTTGGATTTTCCTG
CTGCTGCCTCAACTGTATGCCAATTTCAAGGCAAAGAGCGCGGATGGACTGAGCCTGGTCTTCCTCTTCGTCTGG
TCGCTGGGCGACATCGCCAATCTCTCAGGCGCTCTGCTCACTAATCTGGCGCCCAGCGCCGTCGCCCTCGCCGGG
TACTTTTGCATCCTGGACCTCACTCTCATCAGCCAATGTCTCTACTACAACGCTCTCAACGCCCAGCTTTCCCGC
TCGAATGACTCGGATGTCGACGCCGACCCGGAACATTCCCCCCTGTTGGCGGACGGTCGCGAACGCTCAGCTGAC
TTGGGCATCGTCGTCGCCGATTCGCCAGCGCCATCGAGTCAGAAACGAGCCGCCTCCGCCGCTGACTCGAACGCC
AGCACCGGCTCGTGGACTCGCAATGGCCTGAGCCTGCTGGGCGTTTACCTGATCGGCCTGGCCGGCTGGTTCGTC
TCGTACAAGGCGGGTGCCTGGGGTCACACCCCGCCAAACGCCCCTGATCTCCCTCCGCCGAAGCACGACATGGGC
GCGACCGTCGGCGTCGTCTTGGGATACGTCAGTGCCGCCTTTTACCTCTGCGCTCGGATCCCGCAGATTGTCAAG
AATTACCGAGAAAAATCATGTCAAGGCTTGTCATTGCTGTTCTTCATGCTGTCTCTGACGGGCAACCTGACATAC
GGCCTGAGTCTGATTGCCTACTCGCAGGAGTCGGATTACCTGGTCAAGTCGCTGCCCTGGCTGCTGGGCTCGCTG
GGCACCATGGTAGAGGACGGGGCGATTTTCGTCCAGTTTCGGCTTTACGCCAGCGGGAGTCGAGTTGAAGACCCG
GACCTTTAG
Gene >Ophcf2|03467
ATGGCCTCGTCCGCTCTAACCGACGCCTTGTCCGGCATCTTTGGCAGCATCAGCCTGACCGCTTGGATTTTCCTG
CTGGTGCGTCACCACCCAGAGCGTATGCGAGTCACTGATTGACCGCCCTTCAGCTGCCTCAACTGTATGCCAATT
TCAAGGCAAAGAGCGCGGATGGACTGAGCCTGGTCTTCCTCTTCGTCTGGTCGCTGGGCGACATCGCCAATCTCT
CAGGTGCCTCATCCTCCCCGACCATCGGGGACACGGAGATGAGATTGACGGTCGAGTCCAAACCCAGGCGCTCTG
CTCACTAATCTGGCGCCCAGCGCCGTCGCCCTCGCCGGGTACTTTTGCATCCTGGACCTCACTCTCATCAGCCAA
TGTCTCTACTACAACGCTCTCAACGCCCAGCTTTCCCGCTCGAATGACTCGGATGTCGACGCCGACCCGGAACAT
TCCCCCCTGTTGGCGGACGGTCGCGAACGCTCAGCTGACTTGGGCATCGTCGTCGCCGATTCGCCAGCGCCATCG
AGTCAGAAACGAGCCGCCTCCGCCGCTGACTCGAACGCCAGCACCGGCTCGTGGACTCGCAATGGCCTGAGCCTG
CTGGGCGTTTACCTGATCGGCCTGGCCGGCTGGTTCGTCTCGTACAAGGCGGGTGCCTGGGGTCACACCCCGCCA
AACGCCCCTGATCTCCCTCCGCCGAAGCACGACATGGGCGCGACCGTCGGCGTCGTCTTGGGATACGTCAGTGCC
GCCTTTTACCTCTGGTGAGATTCGTCCGCGAGCCGGTCCCTTCGGAAGGATGCTGACGGCCAACTCGCAGCGCTC
GGATCCCGCAGATTGTCAAGAATTACCGAGAAAAATCATGTCAAGGTCAGGGACCTCGTCTCACCCGATGGAGCC
ACGAATGTTCTCTAACGAGCGCCTCAGGCTTGTCATTGCTGTTCTTCATGCTGTCTCTGACGGGCAACCTGACAT
ACGGCCTGAGTCTGATTGCCTACTCGCAGGAGTCGGATTACCTGGTCAAGTCGCTGCCCTGGCTGCTGGGCTCGC
TGGGCACCATGGTAGAGGACGGGGCGATTTTCGTCCAGTTTCGGCTTTACGCCAGCGGGAGTCGAGTTGAAGACC
CGGACCTTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail