Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03467
Gene name
Locationscaffold_03:2782469..2783605
Strand+
Gene length (bp)1136
Transcript length (bp)909
Coding sequence length (bp)909
Protein length (aa) 303

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04193 PQ-loop PQ loop repeat 1.9E-17 10 68
PF04193 PQ-loop PQ loop repeat 1.4E-20 204 260

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 33 0.5

Transmembrane Domains

Domain # Start End Length
1 10 32 22
2 45 67 22
3 72 94 22
4 162 184 22
5 199 221 22
6 234 256 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03467
MASSALTDALSGIFGSISLTAWIFLLLPQLYANFKAKSADGLSLVFLFVWSLGDIANLSGALLTNLAPSAVALAG
YFCILDLTLISQCLYYNALNAQLSRSNDSDVDADPEHSPLLADGRERSADLGIVVADSPAPSSQKRAASAADSNA
STGSWTRNGLSLLGVYLIGLAGWFVSYKAGAWGHTPPNAPDLPPPKHDMGATVGVVLGYVSAAFYLCARIPQIVK
NYREKSCQGLSLLFFMLSLTGNLTYGLSLIAYSQESDYLVKSLPWLLGSLGTMVEDGAIFVQFRLYASGSRVEDP
DL*
Coding >Ophcf2|03467
ATGGCCTCGTCCGCTCTAACCGACGCCTTGTCCGGCATCTTTGGCAGCATCAGCCTGACCGCTTGGATTTTCCTG
CTGCTGCCTCAACTGTATGCCAATTTCAAGGCAAAGAGCGCGGATGGACTGAGCCTGGTCTTCCTCTTCGTCTGG
TCGCTGGGCGACATCGCCAATCTCTCAGGCGCTCTGCTCACTAATCTGGCGCCCAGCGCCGTCGCCCTCGCCGGG
TACTTTTGCATCCTGGACCTCACTCTCATCAGCCAATGTCTCTACTACAACGCTCTCAACGCCCAGCTTTCCCGC
TCGAATGACTCGGATGTCGACGCCGACCCGGAACATTCCCCCCTGTTGGCGGACGGTCGCGAACGCTCAGCTGAC
TTGGGCATCGTCGTCGCCGATTCGCCAGCGCCATCGAGTCAGAAACGAGCCGCCTCCGCCGCTGACTCGAACGCC
AGCACCGGCTCGTGGACTCGCAATGGCCTGAGCCTGCTGGGCGTTTACCTGATCGGCCTGGCCGGCTGGTTCGTC
TCGTACAAGGCGGGTGCCTGGGGTCACACCCCGCCAAACGCCCCTGATCTCCCTCCGCCGAAGCACGACATGGGC
GCGACCGTCGGCGTCGTCTTGGGATACGTCAGTGCCGCCTTTTACCTCTGCGCTCGGATCCCGCAGATTGTCAAG
AATTACCGAGAAAAATCATGTCAAGGCTTGTCATTGCTGTTCTTCATGCTGTCTCTGACGGGCAACCTGACATAC
GGCCTGAGTCTGATTGCCTACTCGCAGGAGTCGGATTACCTGGTCAAGTCGCTGCCCTGGCTGCTGGGCTCGCTG
GGCACCATGGTAGAGGACGGGGCGATTTTCGTCCAGTTTCGGCTTTACGCCAGCGGGAGTCGAGTTGAAGACCCG
GACCTTTAG
Transcript >Ophcf2|03467
ATGGCCTCGTCCGCTCTAACCGACGCCTTGTCCGGCATCTTTGGCAGCATCAGCCTGACCGCTTGGATTTTCCTG
CTGCTGCCTCAACTGTATGCCAATTTCAAGGCAAAGAGCGCGGATGGACTGAGCCTGGTCTTCCTCTTCGTCTGG
TCGCTGGGCGACATCGCCAATCTCTCAGGCGCTCTGCTCACTAATCTGGCGCCCAGCGCCGTCGCCCTCGCCGGG
TACTTTTGCATCCTGGACCTCACTCTCATCAGCCAATGTCTCTACTACAACGCTCTCAACGCCCAGCTTTCCCGC
TCGAATGACTCGGATGTCGACGCCGACCCGGAACATTCCCCCCTGTTGGCGGACGGTCGCGAACGCTCAGCTGAC
TTGGGCATCGTCGTCGCCGATTCGCCAGCGCCATCGAGTCAGAAACGAGCCGCCTCCGCCGCTGACTCGAACGCC
AGCACCGGCTCGTGGACTCGCAATGGCCTGAGCCTGCTGGGCGTTTACCTGATCGGCCTGGCCGGCTGGTTCGTC
TCGTACAAGGCGGGTGCCTGGGGTCACACCCCGCCAAACGCCCCTGATCTCCCTCCGCCGAAGCACGACATGGGC
GCGACCGTCGGCGTCGTCTTGGGATACGTCAGTGCCGCCTTTTACCTCTGCGCTCGGATCCCGCAGATTGTCAAG
AATTACCGAGAAAAATCATGTCAAGGCTTGTCATTGCTGTTCTTCATGCTGTCTCTGACGGGCAACCTGACATAC
GGCCTGAGTCTGATTGCCTACTCGCAGGAGTCGGATTACCTGGTCAAGTCGCTGCCCTGGCTGCTGGGCTCGCTG
GGCACCATGGTAGAGGACGGGGCGATTTTCGTCCAGTTTCGGCTTTACGCCAGCGGGAGTCGAGTTGAAGACCCG
GACCTTTAG
Gene >Ophcf2|03467
ATGGCCTCGTCCGCTCTAACCGACGCCTTGTCCGGCATCTTTGGCAGCATCAGCCTGACCGCTTGGATTTTCCTG
CTGGTGCGTCACCACCCAGAGCGTATGCGAGTCACTGATTGACCGCCCTTCAGCTGCCTCAACTGTATGCCAATT
TCAAGGCAAAGAGCGCGGATGGACTGAGCCTGGTCTTCCTCTTCGTCTGGTCGCTGGGCGACATCGCCAATCTCT
CAGGTGCCTCATCCTCCCCGACCATCGGGGACACGGAGATGAGATTGACGGTCGAGTCCAAACCCAGGCGCTCTG
CTCACTAATCTGGCGCCCAGCGCCGTCGCCCTCGCCGGGTACTTTTGCATCCTGGACCTCACTCTCATCAGCCAA
TGTCTCTACTACAACGCTCTCAACGCCCAGCTTTCCCGCTCGAATGACTCGGATGTCGACGCCGACCCGGAACAT
TCCCCCCTGTTGGCGGACGGTCGCGAACGCTCAGCTGACTTGGGCATCGTCGTCGCCGATTCGCCAGCGCCATCG
AGTCAGAAACGAGCCGCCTCCGCCGCTGACTCGAACGCCAGCACCGGCTCGTGGACTCGCAATGGCCTGAGCCTG
CTGGGCGTTTACCTGATCGGCCTGGCCGGCTGGTTCGTCTCGTACAAGGCGGGTGCCTGGGGTCACACCCCGCCA
AACGCCCCTGATCTCCCTCCGCCGAAGCACGACATGGGCGCGACCGTCGGCGTCGTCTTGGGATACGTCAGTGCC
GCCTTTTACCTCTGGTGAGATTCGTCCGCGAGCCGGTCCCTTCGGAAGGATGCTGACGGCCAACTCGCAGCGCTC
GGATCCCGCAGATTGTCAAGAATTACCGAGAAAAATCATGTCAAGGTCAGGGACCTCGTCTCACCCGATGGAGCC
ACGAATGTTCTCTAACGAGCGCCTCAGGCTTGTCATTGCTGTTCTTCATGCTGTCTCTGACGGGCAACCTGACAT
ACGGCCTGAGTCTGATTGCCTACTCGCAGGAGTCGGATTACCTGGTCAAGTCGCTGCCCTGGCTGCTGGGCTCGC
TGGGCACCATGGTAGAGGACGGGGCGATTTTCGTCCAGTTTCGGCTTTACGCCAGCGGGAGTCGAGTTGAAGACC
CGGACCTTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail