Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03465
Gene name
Locationscaffold_03:2774569..2775186
Strand+
Gene length (bp)617
Transcript length (bp)420
Coding sequence length (bp)420
Protein length (aa) 140

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03669 ASTER PAT complex subunit Asterix 3.4E-06 28 114

GO

GO Term Description Terminal node
GO:0044183 protein folding chaperone Yes
GO:0030176 integral component of endoplasmic reticulum membrane Yes
GO:0045048 protein insertion into ER membrane Yes
GO:0031300 intrinsic component of organelle membrane No
GO:0051234 establishment of localization No
GO:0110165 cellular anatomical entity No
GO:0070727 cellular macromolecule localization No
GO:0009987 cellular process No
GO:0033036 macromolecule localization No
GO:0008104 protein localization No
GO:0090150 establishment of protein localization to membrane No
GO:0016021 integral component of membrane No
GO:0031224 intrinsic component of membrane No
GO:0072657 protein localization to membrane No
GO:0051668 localization within membrane No
GO:0051641 cellular localization No
GO:0031227 intrinsic component of endoplasmic reticulum membrane No
GO:0005575 cellular_component No
GO:0031301 integral component of organelle membrane No
GO:0051205 protein insertion into membrane No
GO:0003674 molecular_function No
GO:0045184 establishment of protein localization No
GO:0008150 biological_process No
GO:0051179 localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 36 0.45

Transmembrane Domains

Domain # Start End Length
1 100 122 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 197.49 106.34 288.65
Alive In ants, during behavior modification 178.06 93.82 262.31
Dead In ants, recently dead 157.28 81.08 233.48

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.666590 no
Alive Dead 0.544032 no
Dead Fungus 0.298825 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03465
MTMTVTSKSPTKRLASSRKAQRKMAPVKDMRRQDLIVPYQEPAATGDKGDLSSTVATTMPMAAMFTRNKFIGWAA
VVFSIQSWLGESEEARKSGGTPGYFTVLMSVMALGVTYLPLVLPPAVSGPAASGTSAPLPVPPR*
Coding >Ophcf2|03465
ATGACAATGACAGTAACATCAAAGTCCCCAACCAAACGACTCGCCAGCAGCCGCAAAGCCCAGCGAAAAATGGCG
CCCGTCAAAGACATGCGACGACAAGATCTAATCGTGCCGTACCAAGAACCGGCGGCGACGGGCGACAAGGGGGAT
CTTTCGTCGACGGTTGCGACGACGATGCCTATGGCCGCTATGTTTACGCGCAACAAGTTCATCGGCTGGGCCGCC
GTCGTCTTCTCCATTCAGAGCTGGCTAGGCGAAAGCGAAGAAGCCAGAAAGAGCGGCGGAACACCGGGATATTTC
ACCGTCCTCATGTCCGTTATGGCTTTGGGGGTTACCTATCTTCCGCTTGTTTTGCCGCCGGCCGTGTCTGGACCG
GCTGCTTCTGGGACGTCTGCTCCGCTGCCGGTGCCGCCTCGTTGA
Transcript >Ophcf2|03465
ATGACAATGACAGTAACATCAAAGTCCCCAACCAAACGACTCGCCAGCAGCCGCAAAGCCCAGCGAAAAATGGCG
CCCGTCAAAGACATGCGACGACAAGATCTAATCGTGCCGTACCAAGAACCGGCGGCGACGGGCGACAAGGGGGAT
CTTTCGTCGACGGTTGCGACGACGATGCCTATGGCCGCTATGTTTACGCGCAACAAGTTCATCGGCTGGGCCGCC
GTCGTCTTCTCCATTCAGAGCTGGCTAGGCGAAAGCGAAGAAGCCAGAAAGAGCGGCGGAACACCGGGATATTTC
ACCGTCCTCATGTCCGTTATGGCTTTGGGGGTTACCTATCTTCCGCTTGTTTTGCCGCCGGCCGTGTCTGGACCG
GCTGCTTCTGGGACGTCTGCTCCGCTGCCGGTGCCGCCTCGTTGA
Gene >Ophcf2|03465
ATGACAATGACAGTAACATCAAAGTCCCCAACCAAACGACTCGCCAGCAGCCGCAAAGCCCAGCGAAAAATGGCG
CCCGTCAAAGACATGCGACGACAAGATCTAAGTGATCCCCCCCCGCCCCCCATCCTCCCCTAATCCCTTACGAGG
AAGATCCCCCCCCCGCTAACAGACAAAAGTCGTGCCGTACCAAGAACCGGCGGCGACGGGCGACAAGGGGGATCT
TTCGTCGACGGTTGCGACGACGATGCCTATGGCCGCTATGTTTACGCGCAACAAGTTCATCGGCTGGTTCGTTTA
AACCCCCGTGATACGACGAACAAGGAGACACAATTGAGACAAGGGCACGCAGGGCCGCCGTCGTCTTCTCCATTC
AGAGCTGGCTAGGCGAAAGCGAAGAAGCCAGAAAGAGCGGCGGAACACCGGGATATTTCACCGTCCTCATGTCCG
GTGAGTCTGCTCTCTCCCGGTTTCCCTGTAATTACATACTTTGGGAGCTGACGAGGTCGGCAGTTATGGCTTTGG
GGGTTACCTATCTTCCGCTTGTTTTGCCGCCGGCCGTGTCTGGACCGGCTGCTTCTGGGACGTCTGCTCCGCTGC
CGGTGCCGCCTCGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail