Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03465
Gene name
Locationscaffold_03:2774569..2775186
Strand+
Gene length (bp)617
Transcript length (bp)420
Coding sequence length (bp)420
Protein length (aa) 140

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03669 ASTER PAT complex subunit Asterix 3.4E-06 28 114

GO

GO Term Description Terminal node
GO:0044183 protein folding chaperone Yes
GO:0030176 integral component of endoplasmic reticulum membrane Yes
GO:0045048 protein insertion into ER membrane Yes
GO:0031300 intrinsic component of organelle membrane No
GO:0051234 establishment of localization No
GO:0110165 cellular anatomical entity No
GO:0070727 cellular macromolecule localization No
GO:0009987 cellular process No
GO:0033036 macromolecule localization No
GO:0008104 protein localization No
GO:0090150 establishment of protein localization to membrane No
GO:0016021 integral component of membrane No
GO:0031224 intrinsic component of membrane No
GO:0072657 protein localization to membrane No
GO:0051668 localization within membrane No
GO:0051641 cellular localization No
GO:0031227 intrinsic component of endoplasmic reticulum membrane No
GO:0005575 cellular_component No
GO:0031301 integral component of organelle membrane No
GO:0051205 protein insertion into membrane No
GO:0003674 molecular_function No
GO:0045184 establishment of protein localization No
GO:0008150 biological_process No
GO:0051179 localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 36 0.45

Transmembrane Domains

Domain # Start End Length
1 100 122 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03465
MTMTVTSKSPTKRLASSRKAQRKMAPVKDMRRQDLIVPYQEPAATGDKGDLSSTVATTMPMAAMFTRNKFIGWAA
VVFSIQSWLGESEEARKSGGTPGYFTVLMSVMALGVTYLPLVLPPAVSGPAASGTSAPLPVPPR*
Coding >Ophcf2|03465
ATGACAATGACAGTAACATCAAAGTCCCCAACCAAACGACTCGCCAGCAGCCGCAAAGCCCAGCGAAAAATGGCG
CCCGTCAAAGACATGCGACGACAAGATCTAATCGTGCCGTACCAAGAACCGGCGGCGACGGGCGACAAGGGGGAT
CTTTCGTCGACGGTTGCGACGACGATGCCTATGGCCGCTATGTTTACGCGCAACAAGTTCATCGGCTGGGCCGCC
GTCGTCTTCTCCATTCAGAGCTGGCTAGGCGAAAGCGAAGAAGCCAGAAAGAGCGGCGGAACACCGGGATATTTC
ACCGTCCTCATGTCCGTTATGGCTTTGGGGGTTACCTATCTTCCGCTTGTTTTGCCGCCGGCCGTGTCTGGACCG
GCTGCTTCTGGGACGTCTGCTCCGCTGCCGGTGCCGCCTCGTTGA
Transcript >Ophcf2|03465
ATGACAATGACAGTAACATCAAAGTCCCCAACCAAACGACTCGCCAGCAGCCGCAAAGCCCAGCGAAAAATGGCG
CCCGTCAAAGACATGCGACGACAAGATCTAATCGTGCCGTACCAAGAACCGGCGGCGACGGGCGACAAGGGGGAT
CTTTCGTCGACGGTTGCGACGACGATGCCTATGGCCGCTATGTTTACGCGCAACAAGTTCATCGGCTGGGCCGCC
GTCGTCTTCTCCATTCAGAGCTGGCTAGGCGAAAGCGAAGAAGCCAGAAAGAGCGGCGGAACACCGGGATATTTC
ACCGTCCTCATGTCCGTTATGGCTTTGGGGGTTACCTATCTTCCGCTTGTTTTGCCGCCGGCCGTGTCTGGACCG
GCTGCTTCTGGGACGTCTGCTCCGCTGCCGGTGCCGCCTCGTTGA
Gene >Ophcf2|03465
ATGACAATGACAGTAACATCAAAGTCCCCAACCAAACGACTCGCCAGCAGCCGCAAAGCCCAGCGAAAAATGGCG
CCCGTCAAAGACATGCGACGACAAGATCTAAGTGATCCCCCCCCGCCCCCCATCCTCCCCTAATCCCTTACGAGG
AAGATCCCCCCCCCGCTAACAGACAAAAGTCGTGCCGTACCAAGAACCGGCGGCGACGGGCGACAAGGGGGATCT
TTCGTCGACGGTTGCGACGACGATGCCTATGGCCGCTATGTTTACGCGCAACAAGTTCATCGGCTGGTTCGTTTA
AACCCCCGTGATACGACGAACAAGGAGACACAATTGAGACAAGGGCACGCAGGGCCGCCGTCGTCTTCTCCATTC
AGAGCTGGCTAGGCGAAAGCGAAGAAGCCAGAAAGAGCGGCGGAACACCGGGATATTTCACCGTCCTCATGTCCG
GTGAGTCTGCTCTCTCCCGGTTTCCCTGTAATTACATACTTTGGGAGCTGACGAGGTCGGCAGTTATGGCTTTGG
GGGTTACCTATCTTCCGCTTGTTTTGCCGCCGGCCGTGTCTGGACCGGCTGCTTCTGGGACGTCTGCTCCGCTGC
CGGTGCCGCCTCGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail