Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03460
Gene name
Locationscaffold_03:2763242..2765773
Strand+
Gene length (bp)2531
Transcript length (bp)1527
Coding sequence length (bp)1527
Protein length (aa) 509

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00171 Aldedh Aldehyde dehydrogenase family 4.9E-61 10 312
PF00171 Aldedh Aldehyde dehydrogenase family 1.5E-11 375 449

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Endoplasmic reticulum Peroxisomal targeting signal 0.4641 0.1309 0.3661 0.0691 0.3984 0.5439 0.5501 0.0991 0.3408 0.2837

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5911
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7189
Ophiocordyceps australis map64 (Brazil) OphauB2|5722
Ophiocordyceps camponoti-floridani Ophcf2|03460 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|5439
Ophiocordyceps kimflemingae Ophio5|2333

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03460
MWKSLYLGLVNPSSPAAVDRAVTAAAHAQRRWAGTSFKQRRAVLRSLLRHVLDNAGEICRVAALDSGKTLADAHL
GELLVTAERIRWTISNGERALRTERKGTSPLMAHKRNSIRYEPLGVVAALVSWNYPFHNMLGPVISSLFAGNAII
VKVSEQTAWSAAYFCAIARGALVANGHDGQLVHALVCWPPAASHLVSHPLVRHVTFIGSRDVARKVAVAAAKGPK
PMVAELGGKDACLVLDSASSDLDRIVEVILRGTFQAAGQNCIGIERVIASNHDPPSSIYTRLITALEPRIRALRL
GPEADNSSRTPPPAEPASSSAELDTTTHLTQKATTSRPPSSSTSAPTCPSPRQNASPRSSASSPAPPPPLLHPPL
ANAPDFGLGASVFARESDPNLDPIISGLRTGMVAVNDFAAYYPASLPFGGVAGSGYGRFAGEEGLRGLCNAKSVC
EDRFAWLGVRTAIPRLLRYPVAQQSRAWEFAHGLVEIAYGGFANKLRGLRRVLRSLYA*
Coding >Ophcf2|03460
ATGTGGAAGAGCCTCTACCTAGGCCTCGTGAACCCATCGTCTCCCGCGGCCGTCGACCGCGCTGTCACGGCGGCA
GCGCACGCGCAGAGACGATGGGCGGGCACGAGTTTCAAGCAGCGGCGGGCGGTGCTGAGGAGTTTGCTGCGTCAT
GTCCTGGACAACGCGGGGGAGATCTGCCGTGTTGCTGCGCTGGATAGTGGGAAGACGTTGGCGGATGCGCATCTG
GGAGAGTTGCTTGTCACGGCTGAGAGGATTCGCTGGACCATTTCCAATGGAGAGCGAGCGCTTCGAACGGAGAGA
AAGGGAACGAGTCCGCTCATGGCTCACAAACGCAACTCGATCCGCTACGAACCCTTGGGCGTCGTCGCCGCCCTG
GTAAGCTGGAACTATCCGTTCCACAACATGCTCGGCCCCGTAATCAGCAGCCTCTTCGCCGGCAACGCCATCATC
GTCAAGGTCTCGGAGCAGACAGCATGGTCAGCAGCATACTTCTGCGCCATCGCCCGCGGCGCCCTGGTAGCCAAC
GGACACGACGGACAACTGGTTCACGCCCTCGTCTGCTGGCCTCCTGCCGCTTCCCATCTTGTTTCCCACCCGTTG
GTCCGGCACGTCACCTTTATCGGATCGAGAGACGTGGCCAGGAAAGTCGCTGTCGCTGCGGCAAAGGGTCCGAAA
CCAATGGTGGCCGAGTTGGGAGGTAAAGATGCCTGTCTGGTTCTCGACTCGGCTTCTTCAGATCTAGATCGCATC
GTCGAGGTCATCCTCCGAGGAACCTTTCAAGCAGCAGGACAAAACTGCATCGGCATAGAACGCGTCATCGCCTCC
AACCACGACCCCCCCTCCTCAATCTACACCCGCCTCATAACCGCCCTCGAACCTCGAATCCGCGCCCTCCGCCTC
GGCCCAGAAGCCGACAACTCATCTCGGACGCCACCTCCCGCGGAGCCCGCCTCCTCGTCGGCGGAACTCGATACA
ACCACCCATCTCACCCAGAAGGCCACTACTTCACGCCCACCCTCCTCGTCGACGTCCGCCCCGACATGCCCATCG
CCCAGACAGAATGCTTCGCCCCGATCCTCTGCCTCATCCCCAGCCCCTCCCCCACCCCTCCTCCATCCTCCCCTC
GCCAACGCCCCTGATTTCGGCCTCGGCGCCTCAGTCTTCGCCCGCGAATCCGACCCCAACCTCGACCCCATCATC
TCGGGCCTACGCACCGGCATGGTCGCCGTAAACGACTTCGCAGCCTACTACCCGGCAAGCCTCCCCTTCGGCGGC
GTCGCCGGCTCGGGATACGGACGCTTCGCCGGTGAAGAGGGCCTGCGCGGCCTGTGCAACGCAAAGAGCGTCTGC
GAGGACCGCTTCGCCTGGTTGGGCGTCAGGACGGCCATCCCTCGCCTGCTGAGGTATCCCGTCGCCCAGCAGAGC
CGGGCTTGGGAGTTTGCCCATGGCCTCGTCGAGATTGCCTATGGGGGGTTCGCGAACAAGCTTAGGGGGTTGAGG
CGTGTTTTGCGGAGTTTGTATGCGTAG
Transcript >Ophcf2|03460
ATGTGGAAGAGCCTCTACCTAGGCCTCGTGAACCCATCGTCTCCCGCGGCCGTCGACCGCGCTGTCACGGCGGCA
GCGCACGCGCAGAGACGATGGGCGGGCACGAGTTTCAAGCAGCGGCGGGCGGTGCTGAGGAGTTTGCTGCGTCAT
GTCCTGGACAACGCGGGGGAGATCTGCCGTGTTGCTGCGCTGGATAGTGGGAAGACGTTGGCGGATGCGCATCTG
GGAGAGTTGCTTGTCACGGCTGAGAGGATTCGCTGGACCATTTCCAATGGAGAGCGAGCGCTTCGAACGGAGAGA
AAGGGAACGAGTCCGCTCATGGCTCACAAACGCAACTCGATCCGCTACGAACCCTTGGGCGTCGTCGCCGCCCTG
GTAAGCTGGAACTATCCGTTCCACAACATGCTCGGCCCCGTAATCAGCAGCCTCTTCGCCGGCAACGCCATCATC
GTCAAGGTCTCGGAGCAGACAGCATGGTCAGCAGCATACTTCTGCGCCATCGCCCGCGGCGCCCTGGTAGCCAAC
GGACACGACGGACAACTGGTTCACGCCCTCGTCTGCTGGCCTCCTGCCGCTTCCCATCTTGTTTCCCACCCGTTG
GTCCGGCACGTCACCTTTATCGGATCGAGAGACGTGGCCAGGAAAGTCGCTGTCGCTGCGGCAAAGGGTCCGAAA
CCAATGGTGGCCGAGTTGGGAGGTAAAGATGCCTGTCTGGTTCTCGACTCGGCTTCTTCAGATCTAGATCGCATC
GTCGAGGTCATCCTCCGAGGAACCTTTCAAGCAGCAGGACAAAACTGCATCGGCATAGAACGCGTCATCGCCTCC
AACCACGACCCCCCCTCCTCAATCTACACCCGCCTCATAACCGCCCTCGAACCTCGAATCCGCGCCCTCCGCCTC
GGCCCAGAAGCCGACAACTCATCTCGGACGCCACCTCCCGCGGAGCCCGCCTCCTCGTCGGCGGAACTCGATACA
ACCACCCATCTCACCCAGAAGGCCACTACTTCACGCCCACCCTCCTCGTCGACGTCCGCCCCGACATGCCCATCG
CCCAGACAGAATGCTTCGCCCCGATCCTCTGCCTCATCCCCAGCCCCTCCCCCACCCCTCCTCCATCCTCCCCTC
GCCAACGCCCCTGATTTCGGCCTCGGCGCCTCAGTCTTCGCCCGCGAATCCGACCCCAACCTCGACCCCATCATC
TCGGGCCTACGCACCGGCATGGTCGCCGTAAACGACTTCGCAGCCTACTACCCGGCAAGCCTCCCCTTCGGCGGC
GTCGCCGGCTCGGGATACGGACGCTTCGCCGGTGAAGAGGGCCTGCGCGGCCTGTGCAACGCAAAGAGCGTCTGC
GAGGACCGCTTCGCCTGGTTGGGCGTCAGGACGGCCATCCCTCGCCTGCTGAGGTATCCCGTCGCCCAGCAGAGC
CGGGCTTGGGAGTTTGCCCATGGCCTCGTCGAGATTGCCTATGGGGGGTTCGCGAACAAGCTTAGGGGGTTGAGG
CGTGTTTTGCGGAGTTTGTATGCGTAG
Gene >Ophcf2|03460
ATGTGGAAGAGTCTGCGTTTTCCGGGAGCGGGAAATGCCCGACGGTTGTTTCTCTATTCCTGTGTCTCTTTTTTC
TTTGTTTTTTTTTTATGTCGTCTTCATCTCCTCATCCCCCTCTCCCACCTTTGTCGGCCCACACGCGCTACATAG
AAGGAAGTGTTTGAGAGCGGGAGTCTGGTCGGTTCAAAATGGGCTGGTTGAGTTGCGTCGTGGGACTCGGGGGGA
GGGAGCACGTCGAGGCGTGTATCTGATATGTAGTAGCTTCTTGTTGGAAACTGAGACGAGTTCTCGAATCTCAAA
GGGAGGGTGGTTGATGATGAGGGGTGATGCCATGCTGTTCCGGCTGGATGCCGTGTTCGGAGCTCCCTAGCTGTA
GTATGTACATATAGTGAGTGGGCTGCCACTTAAAATGAGCAAATCTTAACACCATCACCGCCCTACAGTAAGACA
CTTAGTTAAGATAAGCCGAAGTGAGTGGTAACCCACTGTGTGAGTGGTTACCCACTGTATCTACCCGTAGGTGGC
TGCGATGCTGCTGCTGTGGCTTGTACATACGCATCAGCCACAGGCAACCCACAGCTTCAAGTCTGCAGACTGCAG
TAGAGAACTTCAGCAGCCATCTTATCTTCTGCGACAAGAAAATCTCCAGCATCCATCCAGCAATGGACAGGGCCC
TCGAGTAAGCTCCTCATCCCAATACCCTCCAAAGGCTCACCCTAACCTCCCCTTCCCTCCGCCCCCCCCCCCCCC
CCCCAAGCTCATGGCCATGGTCCCTCCCAACCACAACAACAGCCCTCTGCCTCCTCCTCACCACCCTCCTCCTAA
CCCTCACCCTCACCCTAACCCTCAAACCCCAACCACGAACCTATACCATCCCCGCCCCTCTCCCTCCTTCCCCCC
CCAAACCCTCTCCCAACCCAGCATCCACCTCCCCTCCTCCACCGCAATCCAATGCTACGCCCCAGCAACAGGCCT
CTACCTAGGCCTCGTGAACCCATCGTCTCCCGCGGCCGTCGACCGCGCTGTCACGGCGGCAGCGCACGCGCAGAG
ACGATGGGCGGGCACGAGTTTCAAGCAGCGGCGGGCGGTGCTGAGGAGTTTGCTGCGTCATGTCCTGGACAACGC
GGGGGAGATCTGCCGTGTTGCTGCGCTGGATAGTGGGAAGACGTTGGCGGATGCGCATCTGGGAGAGTTGCTTGT
CACGGCTGAGAGGATTCGCTGGACCATTTCCAATGGAGAGCGAGCGCTTCGAACGGAGAGAAAGGGAACGAGTCC
GCTCATGGCTCACAAACGCAACTCGATCCGCTACGAACCCTTGGGCGTCGTCGCCGCCCTGGTAAGCTGGAACTA
TCCGTTCCACAACATGCTCGGCCCCGTAATCAGCAGCCTCTTCGCCGGCAACGCCATCATCGTCAAGGTCTCGGA
GCAGACAGCATGGTCAGCAGCATACTTCTGCGCCATCGCCCGCGGCGCCCTGGTAGCCAACGGACACGACGGACA
ACTGGTTCACGCCCTCGTCTGCTGGCCTCCTGCCGCTTCCCATCTTGTTTCCCACCCGTTGGTCCGGCACGTCAC
CTTTATCGGATCGAGAGACGTGGCCAGGAAAGTCGCTGTCGCTGCGGCAAAGGGTCCGAAACCAATGGTGGCCGA
GTTGGGAGGTAAAGATGCCTGTCTGGTTCTCGACTCGGCTTCTTCAGATCTAGATCGCATCGTCGAGGTCATCCT
CCGAGGAACCTTTCAAGCAGCAGGACAAAACTGCATCGGCATAGAACGCGTCATCGCCTCCAACCACGACCCCCC
CTCCTCAATCTACACCCGCCTCATAACCGCCCTCGAACCTCGAATCCGCGCCCTCCGCCTCGGCCCAGAAGCCGA
CGTAGGATCCCTCATCTCGGAATCCCCCATCCCCCGTCTCCAAGAACTCATCTCGGACGCCACCTCCCGCGGAGC
CCGCCTCCTCGTCGGCGGAACTCGATACAACCACCCATCTCACCCAGAAGGCCACTACTTCACGCCCACCCTCCT
CGTCGACGTCCGCCCCGACATGCCCATCGCCCAGACAGAATGCTTCGCCCCGATCCTCTGCCTCATCCCCAGCCC
CTCCCCCACCCCTCCTCCATCCTCCCCTCGCCAACGCCCCTGATTTCGGCCTCGGCGCCTCAGTCTTCGCCCGCG
AATCCGACCCCAACCTCGACCCCATCATCTCGGGCCTACGCACCGGCATGGTCGCCGTAAACGACTTCGCAGCCT
ACTACCCGGCAAGCCTCCCCTTCGGCGGCGTCGCCGGCTCGGGATACGGACGCTTCGCCGGTGAAGAGGGCCTGC
GCGGCCTGTGCAACGCAAAGAGCGTCTGCGAGGACCGCTTCGCCTGGTTGGGCGTCAGGACGGCCATCCCTCGCC
TGCTGAGGTATCCCGTCGCCCAGCAGAGCCGGGCTTGGGAGTTTGCCCATGGCCTCGTCGAGATTGCCTATGGGG
GGTTCGCGAACAAGCTTAGGGGGTTGAGGCGTGTTTTGCGGAGTTTGTATGCGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail