Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03459
Gene name
Locationscaffold_03:2758068..2762894
Strand+
Gene length (bp)4826
Transcript length (bp)4653
Coding sequence length (bp)4653
Protein length (aa) 1551

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16212 PhoLip_ATPase_C Phospholipid-translocating P-type ATPase C-terminal 5.3E-75 1105 1354
PF16209 PhoLip_ATPase_N Phospholipid-translocating ATPase N-terminal 2.2E-18 109 158
PF13246 Cation_ATPase Cation transport ATPase (P-type) 1.2E-12 755 834
PF00702 Hydrolase haloacid dehalogenase-like hydrolase 1.1E-07 621 1001

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.45

Transmembrane Domains

Domain # Start End Length
1 140 174 34
2 512 534 22
3 558 580 22
4 1140 1157 17
5 1167 1189 22
6 1220 1242 22
7 1257 1279 22
8 1286 1308 22
9 1323 1345 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 34.44 19.24 49.65
Alive In ants, during behavior modification 32.79 17.58 48.01
Dead In ants, recently dead 37.92 20.94 54.90

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.844457 no
Alive Dead 0.435177 no
Dead Fungus 0.670904 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03459
MTSANGSAPGADGKPQKMERSHRTRWATRKMTIKSGRSKRLSLLNRMQQRKRASNEKPTAGDTPEPPLTDRSSDD
DSDDSSQSEDSGRTLFFNLPLPEDLLSDGHPIQIFPRNKIRTAKYTPLSFIPKNLWFQFHNVANIFFLFLVILGI
FPIFGGVNPGLNAVPLIFIIVVTAIKDAVEDYRRTVLDNELNNAPVHRLSHWDNVNVEEGTVSSWRRFKKANSRL
FGRMWHAIESLWSQKARTARAERKERKLHEGDVEDEVRPSVETTRTNRMSVRDALSSPFSRDSFKSAEDDILMTP
VGSPKALGDLPTIELPDDQDARRAASLRSMKSDLVNYRRAPEGAKFKKDTWKSIQVGDFVRIYNDDELPADVIIL
STSDPDGACYVETKNLDGETNLKVRQALRCGRTLKHARDCERAEFQIKSEPPQPNLYKYNGALHWQQPVPGYPED
EPADMTEPITIDNLLLRGCNLRNTEWVLGVVIFTGHDTKIMMNAGMTPSKRSRIAREMNFNVICNFGILLIMCLL
SGILNGVAWGKTDASLRFFDFGSIGGSAAMSGFITFWAAIIVFQNLVPISLYITLEIVRTLQAVLIFSDIDMYYA
KIDQPCIPKSWNISDDVGQIEYIFSDKTGTLTQNVMEFKKASINGQPYGEAFTEAQAGMQKRLGVDVAAEADRIE
AEIAEAKVKALTGLRKLYDNPYLHDEQVTFIAPDFVTDLAGQGGPQQQAANEEFMLALALCHTVIAERSLGDPPS
MLFKAQSPDEEALVATARDMGFTVINNNTDGIDLNVLGQDRHYPILNTIEFNSSRKRMSSIVRMPDGQIVLYCKG
ADSIIYSRLKRGEQQQLRRQTAEHLEMFAREGLRTLCIARKTLSEKEYEAWKKEHDAAAAALENREEKLETVAEL
IEQDLMLLGGTAIEDRLQDGVPDTIALLGQAGMKLWVLTGDKVETAINIGFSCNLLNNDMELIHLKLDEDETGET
SDETFLATTEKLLEQNLQIFDLVGDDADLAAAKKNHEPPAPTHGLVIDGFTLRWALNDRLRQKFLILCKQCKSVL
CCRVSPAQKASVVAMVKGGLDVMTLSIGDGANDVAMIQEADVGVGIAGVEGRQAAMSSDYAIAQFRFLQRLMLVH
GRWDYRRLAESIANFFYKNVVWTFAIFWFEIFCDFDITYPFDYTYILLFNLIFTSLPVGIMGVLDQDVSDKVSLA
VPQLYRRGIERLEWTHRKFWLYMIDGLYQSVMVFFIPYLLFVPAQPVSFSGLGLEDRLRFGAYVAHPAVVTINAY
ILINTYRWDWLMLLVVSLSDLSIFFWTGVYTSFVSSGFFFKTAAEVYGEASFWAIFFIVPVICLFPRFAVKSLQK
VYWPYDVDIIREQEKMGAFAYLTEGDRANERHGSDGSSQKSGSSNKKTKHMVSGSVDDDLRPIYPPSTATRTTAH
NRTQNGSDSTNFSADASLDAVAATGANTLSAEASAEEQRPSGDAMRPSADRMRPSYDRMRMSMDRVRPSFEASSD
FTSAARLQRIESTQSVGFKARLRALSLTKNAGQGSPMSPRSPRSPRTRRS*
Coding >Ophcf2|03459
ATGACCTCGGCCAATGGCTCCGCGCCTGGCGCCGACGGCAAACCGCAAAAGATGGAACGCTCCCATCGGACACGC
TGGGCAACCCGAAAGATGACCATCAAGAGCGGCCGCTCCAAGCGCCTGTCGCTACTCAACCGCATGCAGCAACGG
AAACGCGCATCCAACGAGAAGCCCACGGCCGGCGACACTCCCGAGCCGCCCCTGACGGATCGCAGCAGCGACGAC
GATTCCGACGACTCGTCCCAATCCGAAGACAGCGGACGCACGCTCTTCTTCAACCTACCCCTGCCCGAAGACTTG
CTGAGCGACGGCCATCCCATCCAGATTTTCCCCCGGAATAAGATCAGGACCGCAAAGTACACGCCGCTTTCCTTC
ATTCCCAAGAACCTGTGGTTCCAGTTCCACAATGTGGCCAACATATTTTTCCTCTTCCTCGTCATTCTCGGAATT
TTCCCCATATTTGGCGGCGTCAACCCGGGCCTCAACGCCGTGCCCCTCATCTTCATCATCGTCGTCACCGCCATC
AAAGACGCAGTCGAGGATTACCGACGAACCGTCCTCGACAATGAGCTCAACAATGCTCCTGTCCACCGACTGTCT
CACTGGGACAACGTCAATGTCGAAGAGGGGACCGTCTCTTCTTGGAGGAGGTTCAAGAAGGCAAACTCGAGACTC
TTTGGCCGCATGTGGCATGCCATCGAGAGCCTGTGGTCTCAGAAGGCCAGGACCGCCAGGGCCGAGCGCAAGGAG
CGCAAGCTGCACGAGGGCGACGTCGAGGATGAGGTCCGTCCGTCGGTCGAGACGACGCGTACCAACAGGATGTCA
GTCCGCGACGCTCTCTCCTCGCCCTTTAGCCGCGACTCGTTCAAGTCTGCCGAGGACGACATCCTCATGACCCCT
GTCGGCTCCCCCAAAGCCCTCGGCGACCTACCCACCATTGAGCTGCCCGACGACCAAGACGCCAGGCGCGCCGCC
TCGCTCCGGTCCATGAAGTCGGACCTCGTCAACTACCGCCGTGCTCCAGAGGGCGCCAAGTTCAAGAAGGACACA
TGGAAGAGCATCCAGGTGGGCGACTTTGTACGAATATACAACGATGACGAGCTGCCCGCCGACGTCATAATCCTG
TCCACCTCGGACCCCGACGGCGCCTGTTACGTCGAGACGAAGAACCTGGACGGCGAGACGAATCTCAAGGTCCGC
CAGGCTCTCCGCTGCGGCCGGACCCTCAAGCACGCCCGCGACTGCGAAAGGGCCGAGTTCCAAATCAAGAGCGAG
CCGCCGCAGCCCAATCTCTACAAGTACAACGGCGCCCTACACTGGCAACAACCGGTGCCCGGCTACCCGGAGGAC
GAGCCGGCCGACATGACGGAGCCCATCACCATTGACAACCTACTCCTTCGAGGCTGCAACCTCCGCAATACCGAG
TGGGTGCTCGGCGTCGTCATCTTTACCGGCCACGACACAAAAATCATGATGAACGCCGGCATGACCCCTAGCAAA
CGGTCGCGAATCGCCCGCGAGATGAACTTTAACGTCATCTGCAACTTTGGCATCCTGCTCATCATGTGCCTGCTG
TCGGGAATTCTCAACGGCGTCGCTTGGGGCAAGACGGACGCCTCGCTCCGTTTCTTCGACTTTGGTTCCATCGGC
GGCAGCGCAGCCATGAGCGGCTTCATCACCTTTTGGGCCGCCATCATCGTCTTCCAGAACCTGGTACCCATCTCG
CTCTACATCACTCTCGAGATCGTCCGCACCCTTCAGGCCGTTCTCATATTTAGCGACATCGACATGTACTACGCC
AAGATCGATCAGCCTTGTATCCCCAAGTCGTGGAACATTTCGGACGACGTCGGCCAAATCGAATACATCTTCTCC
GACAAGACGGGCACGCTCACGCAAAACGTCATGGAGTTCAAGAAGGCTTCCATAAATGGCCAACCCTATGGCGAG
GCCTTTACCGAGGCCCAGGCCGGCATGCAGAAGCGACTCGGCGTCGACGTCGCGGCCGAGGCGGATAGGATCGAG
GCCGAGATCGCCGAGGCCAAGGTCAAGGCACTGACCGGCCTGCGGAAGCTGTATGACAACCCATACCTCCACGAC
GAACAGGTCACCTTCATCGCGCCCGACTTCGTGACCGACTTGGCCGGCCAAGGCGGGCCGCAGCAGCAGGCGGCC
AACGAGGAGTTCATGCTGGCGCTGGCCCTGTGCCACACCGTCATCGCCGAGAGATCGCTCGGTGATCCGCCGAGC
ATGCTGTTCAAGGCGCAGTCACCCGACGAGGAGGCCCTGGTCGCCACGGCGCGAGATATGGGCTTTACCGTCATC
AACAACAACACCGACGGCATTGACCTCAACGTACTCGGCCAGGACCGCCACTACCCGATCCTCAACACTATCGAA
TTCAACTCGAGCCGGAAACGGATGAGCTCCATAGTGCGGATGCCCGACGGTCAGATCGTCCTCTACTGCAAGGGC
GCCGACTCCATCATCTACTCGCGCCTCAAGCGGGGCGAGCAGCAACAGCTGCGACGCCAGACGGCCGAGCACCTC
GAGATGTTCGCCCGCGAGGGCCTCCGGACGCTCTGCATTGCGAGAAAGACGCTGTCAGAAAAGGAGTATGAGGCG
TGGAAGAAGGAGCACGACGCTGCGGCGGCGGCGCTCGAGAACCGCGAGGAGAAGCTGGAGACGGTGGCGGAGCTC
ATCGAGCAGGACCTGATGCTGCTGGGCGGTACCGCCATCGAGGACCGACTGCAGGACGGCGTGCCCGACACCATC
GCGCTCCTCGGCCAGGCCGGCATGAAGCTGTGGGTGCTGACGGGCGACAAGGTGGAGACGGCCATCAACATCGGC
TTCTCGTGCAACCTGCTCAACAACGACATGGAGCTGATCCACCTCAAGCTCGACGAGGACGAGACGGGGGAGACG
AGCGACGAGACGTTCCTGGCGACGACGGAGAAGCTGCTGGAGCAGAACCTACAGATCTTCGACCTGGTGGGCGAC
GACGCCGACCTGGCGGCGGCCAAGAAGAACCACGAGCCGCCGGCGCCGACGCACGGGCTCGTCATCGACGGCTTC
ACCCTCCGCTGGGCGCTCAACGACCGGCTGCGGCAAAAGTTTCTGATATTGTGCAAGCAGTGCAAGTCTGTGCTG
TGCTGCCGCGTCAGTCCCGCGCAGAAGGCGTCGGTCGTTGCCATGGTCAAGGGGGGGCTGGACGTGATGACGCTG
TCCATCGGCGACGGGGCCAACGACGTGGCCATGATACAGGAGGCCGACGTTGGCGTGGGTATCGCCGGTGTCGAG
GGCCGGCAGGCGGCCATGTCGTCCGACTACGCAATCGCCCAGTTCCGCTTCCTGCAGAGGCTGATGCTGGTGCAC
GGCCGGTGGGACTACCGGCGGCTGGCAGAGAGTATCGCCAACTTCTTCTACAAGAACGTGGTGTGGACCTTTGCC
ATCTTCTGGTTCGAGATCTTTTGCGACTTCGACATCACCTATCCCTTCGACTACACCTACATTCTCCTCTTCAAC
CTCATCTTTACGTCGCTTCCCGTCGGCATCATGGGCGTGCTCGACCAGGACGTCTCGGACAAGGTGTCGCTCGCC
GTGCCTCAGCTGTACCGGCGCGGCATCGAGCGGCTGGAGTGGACGCACCGCAAGTTTTGGTTGTACATGATCGAC
GGTCTTTACCAGTCCGTCATGGTCTTCTTCATCCCATACCTGCTGTTCGTCCCGGCCCAGCCCGTCAGCTTCTCC
GGGCTCGGGCTCGAGGACAGGCTGCGGTTCGGCGCCTACGTGGCGCATCCGGCCGTGGTGACGATCAACGCCTAC
ATCTTGATCAACACGTACCGATGGGACTGGCTGATGCTGCTGGTGGTGAGCCTCAGCGACCTGTCCATCTTTTTC
TGGACGGGCGTCTACACGTCCTTTGTCTCGTCGGGCTTCTTCTTCAAGACGGCGGCCGAGGTCTACGGCGAGGCC
AGCTTCTGGGCCATCTTCTTCATCGTGCCCGTCATCTGCCTGTTCCCGCGGTTCGCGGTGAAGTCGCTGCAGAAG
GTGTACTGGCCGTACGACGTGGACATTATCCGCGAGCAGGAGAAGATGGGGGCCTTTGCCTACCTGACTGAGGGC
GACCGGGCCAACGAGCGGCACGGCAGCGACGGGAGCAGCCAGAAGTCGGGCAGCTCCAACAAGAAGACCAAGCAC
ATGGTCAGTGGGAGCGTCGACGACGACCTTCGGCCCATCTACCCTCCTTCTACGGCGACGCGGACGACGGCTCAC
AACCGGACGCAGAACGGAAGCGACTCGACCAACTTTTCGGCCGACGCGTCGTTGGACGCCGTGGCTGCGACGGGC
GCCAACACGCTGTCGGCGGAGGCGTCTGCCGAAGAGCAGCGGCCATCGGGCGACGCCATGAGGCCGTCGGCCGAC
AGGATGCGTCCGTCGTACGACCGGATGCGTATGTCGATGGACCGGGTGCGGCCCAGCTTCGAGGCCAGCAGCGAC
TTCACGTCGGCGGCGCGGCTGCAGAGGATCGAGTCGACGCAGTCGGTCGGCTTCAAGGCCAGGCTGCGAGCCCTG
TCGTTGACCAAGAACGCCGGCCAGGGCTCGCCGATGAGCCCACGATCACCGCGATCGCCTCGGACGCGGCGGTCA
TGA
Transcript >Ophcf2|03459
ATGACCTCGGCCAATGGCTCCGCGCCTGGCGCCGACGGCAAACCGCAAAAGATGGAACGCTCCCATCGGACACGC
TGGGCAACCCGAAAGATGACCATCAAGAGCGGCCGCTCCAAGCGCCTGTCGCTACTCAACCGCATGCAGCAACGG
AAACGCGCATCCAACGAGAAGCCCACGGCCGGCGACACTCCCGAGCCGCCCCTGACGGATCGCAGCAGCGACGAC
GATTCCGACGACTCGTCCCAATCCGAAGACAGCGGACGCACGCTCTTCTTCAACCTACCCCTGCCCGAAGACTTG
CTGAGCGACGGCCATCCCATCCAGATTTTCCCCCGGAATAAGATCAGGACCGCAAAGTACACGCCGCTTTCCTTC
ATTCCCAAGAACCTGTGGTTCCAGTTCCACAATGTGGCCAACATATTTTTCCTCTTCCTCGTCATTCTCGGAATT
TTCCCCATATTTGGCGGCGTCAACCCGGGCCTCAACGCCGTGCCCCTCATCTTCATCATCGTCGTCACCGCCATC
AAAGACGCAGTCGAGGATTACCGACGAACCGTCCTCGACAATGAGCTCAACAATGCTCCTGTCCACCGACTGTCT
CACTGGGACAACGTCAATGTCGAAGAGGGGACCGTCTCTTCTTGGAGGAGGTTCAAGAAGGCAAACTCGAGACTC
TTTGGCCGCATGTGGCATGCCATCGAGAGCCTGTGGTCTCAGAAGGCCAGGACCGCCAGGGCCGAGCGCAAGGAG
CGCAAGCTGCACGAGGGCGACGTCGAGGATGAGGTCCGTCCGTCGGTCGAGACGACGCGTACCAACAGGATGTCA
GTCCGCGACGCTCTCTCCTCGCCCTTTAGCCGCGACTCGTTCAAGTCTGCCGAGGACGACATCCTCATGACCCCT
GTCGGCTCCCCCAAAGCCCTCGGCGACCTACCCACCATTGAGCTGCCCGACGACCAAGACGCCAGGCGCGCCGCC
TCGCTCCGGTCCATGAAGTCGGACCTCGTCAACTACCGCCGTGCTCCAGAGGGCGCCAAGTTCAAGAAGGACACA
TGGAAGAGCATCCAGGTGGGCGACTTTGTACGAATATACAACGATGACGAGCTGCCCGCCGACGTCATAATCCTG
TCCACCTCGGACCCCGACGGCGCCTGTTACGTCGAGACGAAGAACCTGGACGGCGAGACGAATCTCAAGGTCCGC
CAGGCTCTCCGCTGCGGCCGGACCCTCAAGCACGCCCGCGACTGCGAAAGGGCCGAGTTCCAAATCAAGAGCGAG
CCGCCGCAGCCCAATCTCTACAAGTACAACGGCGCCCTACACTGGCAACAACCGGTGCCCGGCTACCCGGAGGAC
GAGCCGGCCGACATGACGGAGCCCATCACCATTGACAACCTACTCCTTCGAGGCTGCAACCTCCGCAATACCGAG
TGGGTGCTCGGCGTCGTCATCTTTACCGGCCACGACACAAAAATCATGATGAACGCCGGCATGACCCCTAGCAAA
CGGTCGCGAATCGCCCGCGAGATGAACTTTAACGTCATCTGCAACTTTGGCATCCTGCTCATCATGTGCCTGCTG
TCGGGAATTCTCAACGGCGTCGCTTGGGGCAAGACGGACGCCTCGCTCCGTTTCTTCGACTTTGGTTCCATCGGC
GGCAGCGCAGCCATGAGCGGCTTCATCACCTTTTGGGCCGCCATCATCGTCTTCCAGAACCTGGTACCCATCTCG
CTCTACATCACTCTCGAGATCGTCCGCACCCTTCAGGCCGTTCTCATATTTAGCGACATCGACATGTACTACGCC
AAGATCGATCAGCCTTGTATCCCCAAGTCGTGGAACATTTCGGACGACGTCGGCCAAATCGAATACATCTTCTCC
GACAAGACGGGCACGCTCACGCAAAACGTCATGGAGTTCAAGAAGGCTTCCATAAATGGCCAACCCTATGGCGAG
GCCTTTACCGAGGCCCAGGCCGGCATGCAGAAGCGACTCGGCGTCGACGTCGCGGCCGAGGCGGATAGGATCGAG
GCCGAGATCGCCGAGGCCAAGGTCAAGGCACTGACCGGCCTGCGGAAGCTGTATGACAACCCATACCTCCACGAC
GAACAGGTCACCTTCATCGCGCCCGACTTCGTGACCGACTTGGCCGGCCAAGGCGGGCCGCAGCAGCAGGCGGCC
AACGAGGAGTTCATGCTGGCGCTGGCCCTGTGCCACACCGTCATCGCCGAGAGATCGCTCGGTGATCCGCCGAGC
ATGCTGTTCAAGGCGCAGTCACCCGACGAGGAGGCCCTGGTCGCCACGGCGCGAGATATGGGCTTTACCGTCATC
AACAACAACACCGACGGCATTGACCTCAACGTACTCGGCCAGGACCGCCACTACCCGATCCTCAACACTATCGAA
TTCAACTCGAGCCGGAAACGGATGAGCTCCATAGTGCGGATGCCCGACGGTCAGATCGTCCTCTACTGCAAGGGC
GCCGACTCCATCATCTACTCGCGCCTCAAGCGGGGCGAGCAGCAACAGCTGCGACGCCAGACGGCCGAGCACCTC
GAGATGTTCGCCCGCGAGGGCCTCCGGACGCTCTGCATTGCGAGAAAGACGCTGTCAGAAAAGGAGTATGAGGCG
TGGAAGAAGGAGCACGACGCTGCGGCGGCGGCGCTCGAGAACCGCGAGGAGAAGCTGGAGACGGTGGCGGAGCTC
ATCGAGCAGGACCTGATGCTGCTGGGCGGTACCGCCATCGAGGACCGACTGCAGGACGGCGTGCCCGACACCATC
GCGCTCCTCGGCCAGGCCGGCATGAAGCTGTGGGTGCTGACGGGCGACAAGGTGGAGACGGCCATCAACATCGGC
TTCTCGTGCAACCTGCTCAACAACGACATGGAGCTGATCCACCTCAAGCTCGACGAGGACGAGACGGGGGAGACG
AGCGACGAGACGTTCCTGGCGACGACGGAGAAGCTGCTGGAGCAGAACCTACAGATCTTCGACCTGGTGGGCGAC
GACGCCGACCTGGCGGCGGCCAAGAAGAACCACGAGCCGCCGGCGCCGACGCACGGGCTCGTCATCGACGGCTTC
ACCCTCCGCTGGGCGCTCAACGACCGGCTGCGGCAAAAGTTTCTGATATTGTGCAAGCAGTGCAAGTCTGTGCTG
TGCTGCCGCGTCAGTCCCGCGCAGAAGGCGTCGGTCGTTGCCATGGTCAAGGGGGGGCTGGACGTGATGACGCTG
TCCATCGGCGACGGGGCCAACGACGTGGCCATGATACAGGAGGCCGACGTTGGCGTGGGTATCGCCGGTGTCGAG
GGCCGGCAGGCGGCCATGTCGTCCGACTACGCAATCGCCCAGTTCCGCTTCCTGCAGAGGCTGATGCTGGTGCAC
GGCCGGTGGGACTACCGGCGGCTGGCAGAGAGTATCGCCAACTTCTTCTACAAGAACGTGGTGTGGACCTTTGCC
ATCTTCTGGTTCGAGATCTTTTGCGACTTCGACATCACCTATCCCTTCGACTACACCTACATTCTCCTCTTCAAC
CTCATCTTTACGTCGCTTCCCGTCGGCATCATGGGCGTGCTCGACCAGGACGTCTCGGACAAGGTGTCGCTCGCC
GTGCCTCAGCTGTACCGGCGCGGCATCGAGCGGCTGGAGTGGACGCACCGCAAGTTTTGGTTGTACATGATCGAC
GGTCTTTACCAGTCCGTCATGGTCTTCTTCATCCCATACCTGCTGTTCGTCCCGGCCCAGCCCGTCAGCTTCTCC
GGGCTCGGGCTCGAGGACAGGCTGCGGTTCGGCGCCTACGTGGCGCATCCGGCCGTGGTGACGATCAACGCCTAC
ATCTTGATCAACACGTACCGATGGGACTGGCTGATGCTGCTGGTGGTGAGCCTCAGCGACCTGTCCATCTTTTTC
TGGACGGGCGTCTACACGTCCTTTGTCTCGTCGGGCTTCTTCTTCAAGACGGCGGCCGAGGTCTACGGCGAGGCC
AGCTTCTGGGCCATCTTCTTCATCGTGCCCGTCATCTGCCTGTTCCCGCGGTTCGCGGTGAAGTCGCTGCAGAAG
GTGTACTGGCCGTACGACGTGGACATTATCCGCGAGCAGGAGAAGATGGGGGCCTTTGCCTACCTGACTGAGGGC
GACCGGGCCAACGAGCGGCACGGCAGCGACGGGAGCAGCCAGAAGTCGGGCAGCTCCAACAAGAAGACCAAGCAC
ATGGTCAGTGGGAGCGTCGACGACGACCTTCGGCCCATCTACCCTCCTTCTACGGCGACGCGGACGACGGCTCAC
AACCGGACGCAGAACGGAAGCGACTCGACCAACTTTTCGGCCGACGCGTCGTTGGACGCCGTGGCTGCGACGGGC
GCCAACACGCTGTCGGCGGAGGCGTCTGCCGAAGAGCAGCGGCCATCGGGCGACGCCATGAGGCCGTCGGCCGAC
AGGATGCGTCCGTCGTACGACCGGATGCGTATGTCGATGGACCGGGTGCGGCCCAGCTTCGAGGCCAGCAGCGAC
TTCACGTCGGCGGCGCGGCTGCAGAGGATCGAGTCGACGCAGTCGGTCGGCTTCAAGGCCAGGCTGCGAGCCCTG
TCGTTGACCAAGAACGCCGGCCAGGGCTCGCCGATGAGCCCACGATCACCGCGATCGCCTCGGACGCGGCGGTCA
TGA
Gene >Ophcf2|03459
ATGACCTCGGCCAATGGCTCCGCGCCTGGCGCCGACGGCAAACCGCAAAAGATGGAACGCTCCCATCGGACACGC
TGGGCAACCCGAAAGATGACCATCAAGAGCGGCCGCTCCAAGCGCCTGTCGCTACTCAACCGCATGCAGCAACGG
AAACGCGCATCCAACGAGAAGCCCACGGCCGGCGACACTCCCGAGCCGCCCCTGACGGATCGCAGCAGCGACGAC
GATTCCGACGACTCGTCCCAATCCGAAGACAGCGGACGCACGCTCTTCTTCAACCTACCCCTGCCCGAAGACTTG
CTGAGCGACGGCCATCCCATCCAGATTTTCCCCCGGAATAAGATCAGGACCGCAAAGTACACGCCGCTTTCCTTC
ATTCCCAAGAACCTGTGGTTCCAGTTCCACAATGTGGCCAACATATTTTTCCTCTTCCTCGTCATTCTCGGAGTG
AGTAAACCCCTGTCACACTTTACCCGTCCCCCGTCCCCCGTCCCGCCACACCTCGCCTGGCCTCGCACCCCGTCG
CCCGCTGGCCAGTTCGTTAAGCCCTGGCCTACCCGCAGATTTTCCCCATATTTGGCGGCGTCAACCCGGGCCTCA
ACGCCGTGCCCCTCATCTTCATCATCGTCGTCACCGCCATCAAAGACGCAGTCGAGGATTACCGACGAACCGTCC
TCGACAATGAGCTCAACAATGCTCCTGTCCACCGACTGTCTCACTGGGACAACGTCAATGTCGAAGAGGGGACCG
TCTCTTCTTGGAGGAGGTTCAAGAAGGCAAACTCGAGACTCTTTGGCCGCATGTGGCATGCCATCGAGAGCCTGT
GGTCTCAGAAGGCCAGGACCGCCAGGGCCGAGCGCAAGGAGCGCAAGCTGCACGAGGGCGACGTCGAGGATGAGG
TCCGTCCGTCGGTCGAGACGACGCGTACCAACAGGATGTCAGTCCGCGACGCTCTCTCCTCGCCCTTTAGCCGCG
ACTCGTTCAAGTCTGCCGAGGACGACATCCTCATGACCCCTGTCGGCTCCCCCAAAGCCCTCGGCGACCTACCCA
CCATTGAGCTGCCCGACGACCAAGACGCCAGGCGCGCCGCCTCGCTCCGGTCCATGAAGTCGGACCTCGTCAACT
ACCGCCGTGCTCCAGAGGGCGCCAAGTTCAAGAAGGACACATGGAAGAGCATCCAGGTGGGCGACTTTGTACGAA
TATACAACGATGACGAGCTGCCCGCCGACGTCATAATCCTGTCCACCTCGGACCCCGACGGCGCCTGTTACGTCG
AGACGAAGAACCTGGACGGCGAGACGAATCTCAAGGTCCGCCAGGCTCTCCGCTGCGGCCGGACCCTCAAGCACG
CCCGCGACTGCGAAAGGGCCGAGTTCCAAATCAAGAGCGAGCCGCCGCAGCCCAATCTCTACAAGTACAACGGCG
CCCTACACTGGCAACAACCGGTGCCCGGCTACCCGGAGGACGAGCCGGCCGACATGACGGAGCCCATCACCATTG
ACAACCTACTCCTTCGAGGCTGCAACCTCCGCAATACCGAGTGGGTGCTCGGCGTCGTCATCTTTACCGGCCACG
ACACAAAAATCATGATGAACGCCGGCATGACCCCTAGCAAACGGTCGCGAATCGCCCGCGAGATGAACTTTAACG
TCATCTGCAACTTTGGCATCCTGCTCATCATGTGCCTGCTGTCGGGAATTCTCAACGGCGTCGCTTGGGGCAAGA
CGGACGCCTCGCTCCGTTTCTTCGACTTTGGTTCCATCGGCGGCAGCGCAGCCATGAGCGGCTTCATCACCTTTT
GGGCCGCCATCATCGTCTTCCAGAACCTGGTACCCATCTCGCTCTACATCACTCTCGAGATCGTCCGCACCCTTC
AGGCCGTTCTCATATTTAGCGACATCGACATGTACTACGCCAAGATCGATCAGCCTTGTATCCCCAAGTCGTGGA
ACATTTCGGACGACGTCGGCCAAATCGAATACATCTTCTCCGACAAGACGGGCACGCTCACGCAAAACGTCATGG
AGTTCAAGAAGGCTTCCATAAATGGCCAACCCTATGGCGAGGCCTTTACCGAGGCCCAGGCCGGCATGCAGAAGC
GACTCGGCGTCGACGTCGCGGCCGAGGCGGATAGGATCGAGGCCGAGATCGCCGAGGCCAAGGTCAAGGCACTGA
CCGGCCTGCGGAAGCTGTATGACAACCCATACCTCCACGACGAACAGGTCACCTTCATCGCGCCCGACTTCGTGA
CCGACTTGGCCGGCCAAGGCGGGCCGCAGCAGCAGGCGGCCAACGAGGAGTTCATGCTGGCGCTGGCCCTGTGCC
ACACCGTCATCGCCGAGAGATCGCTCGGTGATCCGCCGAGCATGCTGTTCAAGGCGCAGTCACCCGACGAGGAGG
CCCTGGTCGCCACGGCGCGAGATATGGGCTTTACCGTCATCAACAACAACACCGACGGCATTGACCTCAACGTAC
TCGGCCAGGACCGCCACTACCCGATCCTCAACACTATCGAATTCAACTCGAGCCGGAAACGGATGAGCTCCATAG
TGCGGATGCCCGACGGTCAGATCGTCCTCTACTGCAAGGGCGCCGACTCCATCATCTACTCGCGCCTCAAGCGGG
GCGAGCAGCAACAGCTGCGACGCCAGACGGCCGAGCACCTCGAGATGTTCGCCCGCGAGGGCCTCCGGACGCTCT
GCATTGCGAGAAAGACGCTGTCAGAAAAGGAGTATGAGGCGTGGAAGAAGGAGCACGACGCTGCGGCGGCGGCGC
TCGAGAACCGCGAGGAGAAGCTGGAGACGGTGGCGGAGCTCATCGAGCAGGACCTGATGCTGCTGGGCGGTACCG
CCATCGAGGACCGACTGCAGGACGGCGTGCCCGACACCATCGCGCTCCTCGGCCAGGCCGGCATGAAGCTGTGGG
TGCTGACGGGCGACAAGGTGGAGACGGCCATCAACATCGGCTTCTCGTGCAACCTGCTCAACAACGACATGGAGC
TGATCCACCTCAAGCTCGACGAGGACGAGACGGGGGAGACGAGCGACGAGACGTTCCTGGCGACGACGGAGAAGC
TGCTGGAGCAGAACCTACAGATCTTCGACCTGGTGGGCGACGACGCCGACCTGGCGGCGGCCAAGAAGAACCACG
AGCCGCCGGCGCCGACGCACGGGCTCGTCATCGACGGCTTCACCCTCCGCTGGGCGCTCAACGACCGGCTGCGGC
AAAAGTTTCTGATATTGTGCAAGCAGTGCAAGTCTGTGCTGTGCTGCCGCGTCAGTCCCGCGCAGAAGGCGTCGG
TCGTTGCCATGGTCAAGGGGGGGCTGGACGTGATGACGCTGTCCATCGGCGACGGGGCCAACGACGTGGCCATGA
TACAGGAGGCCGACGTTGGCGTGGGTATCGCCGGTGTCGAGGGCCGGCAGGCGGCCATGTCGTCCGACTACGCAA
TCGCCCAGTTCCGCTTCCTGCAGAGGCTGATGCTGGTGCACGGCCGGTGGGACTACCGGCGGCTGGCAGAGAGTA
TCGCCAACTTCTTCTACAAGAACGTGGTGTGGACCTTTGCCATCTTCTGGTTCGAGATCTTTTGCGACTTCGACA
TCACCTATCCCTTCGACTACACCTACATTCTCCTCTTCAACCTCATCTTTACGTCGCTTCCCGTCGGCATCATGG
GCGTGCTCGACCAGGACGTCTCGGACAAGGTGTCGCTCGCCGTGCCTCAGCTGTACCGGCGCGGCATCGAGCGGC
TGGAGTGGACGCACCGCAAGTTTTGGTGAGTGTTTCCGATTATGCCCAATCGGTGGCGGTGGCTGACAAAAAGAC
ACGGCAGGTTGTACATGATCGACGGTCTTTACCAGTCCGTCATGGTCTTCTTCATCCCATACCTGCTGTTCGTCC
CGGCCCAGCCCGTCAGCTTCTCCGGGCTCGGGCTCGAGGACAGGCTGCGGTTCGGCGCCTACGTGGCGCATCCGG
CCGTGGTGACGATCAACGCCTACATCTTGATCAACACGTACCGATGGGACTGGCTGATGCTGCTGGTGGTGAGCC
TCAGCGACCTGTCCATCTTTTTCTGGACGGGCGTCTACACGTCCTTTGTCTCGTCGGGCTTCTTCTTCAAGACGG
CGGCCGAGGTCTACGGCGAGGCCAGCTTCTGGGCCATCTTCTTCATCGTGCCCGTCATCTGCCTGTTCCCGCGGT
TCGCGGTGAAGTCGCTGCAGAAGGTGTACTGGCCGTACGACGTGGACATTATCCGCGAGCAGGAGAAGATGGGGG
CCTTTGCCTACCTGACTGAGGGCGACCGGGCCAACGAGCGGCACGGCAGCGACGGGAGCAGCCAGAAGTCGGGCA
GCTCCAACAAGAAGACCAAGCACATGGTCAGTGGGAGCGTCGACGACGACCTTCGGCCCATCTACCCTCCTTCTA
CGGCGACGCGGACGACGGCTCACAACCGGACGCAGAACGGAAGCGACTCGACCAACTTTTCGGCCGACGCGTCGT
TGGACGCCGTGGCTGCGACGGGCGCCAACACGCTGTCGGCGGAGGCGTCTGCCGAAGAGCAGCGGCCATCGGGCG
ACGCCATGAGGCCGTCGGCCGACAGGATGCGTCCGTCGTACGACCGGATGCGTATGTCGATGGACCGGGTGCGGC
CCAGCTTCGAGGCCAGCAGCGACTTCACGTCGGCGGCGCGGCTGCAGAGGATCGAGTCGACGCAGTCGGTCGGCT
TCAAGGCCAGGCTGCGAGCCCTGTCGTTGACCAAGAACGCCGGCCAGGGCTCGCCGATGAGCCCACGATCACCGC
GATCGCCTCGGACGCGGCGGTCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail