Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03447
Gene name
Locationscaffold_03:2712143..2716862
Strand+
Gene length (bp)4719
Transcript length (bp)4452
Coding sequence length (bp)4452
Protein length (aa) 1484

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13854 Kelch_5 Kelch motif 4.2E-08 282 318
PF13964 Kelch_6 Kelch motif 7.2E-12 285 326
PF13418 Kelch_4 Galactose oxidase, central domain 5.4E-05 227 277
PF13418 Kelch_4 Galactose oxidase, central domain 1.2E-06 285 326
PF13418 Kelch_4 Galactose oxidase, central domain 1.0E-04 335 385
PF01344 Kelch_1 Kelch motif 5.4E-05 228 273
PF01344 Kelch_1 Kelch motif 2.3E-10 285 326
PF13415 Kelch_3 Galactose oxidase, central domain 1.2E-07 295 342
PF13415 Kelch_3 Galactose oxidase, central domain 4.9E-05 346 394
PF07646 Kelch_2 Kelch motif 5.0E-06 285 330

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.6919 0.3308 0.1577 0.3013 0.0983 0.0197 0.1366 0.2553 0.2869 0.0737

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3995
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1674
Ophiocordyceps australis map64 (Brazil) OphauB2|5735
Ophiocordyceps camponoti-floridani Ophcf2|03447 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|1724
Ophiocordyceps kimflemingae Ophio5|6012
Ophiocordyceps subramaniannii Hirsu2|7993

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03447
MAFLFKSKKSQDRALSSRDGNSSSQSSIPPVSSRIPRDEKNAVAQRGTPTGSLNSGDNDVSAASPDHGHTRRGGS
VDTTQQSDLPLRNGPPPTNPNASLYPWSQRRLTYSSSHSSPFPRYGAAVNALSSKEGDIYMMGGLINSSTVKGDL
WLIEAGGSMNCYPLATTAEGPCPRVGHASLLVGNAFIVYGGDTKIKDSDVLDETLYLLNTSTRNWSLALPAGPRP
AGRYGHSLNILGSKIYIFGGQVEGSFMNDLSAFDLNQLQKPSNRWEILVPGEASPKVPAPRTNHSMVTYNDRMYL
FGGTNGFQWFNDVWCYDPSLNSWTQLDCIGYIPAPREGHAAALVDDVMYVFGGRTEEGSDLGDLAAFRISSRRWY
TFQNMGPSPSPRSGHSMTTVGKWIVVLGGEPSAAASTINDLGILYVLDTTKIRYPNDSQQSTQRAVQGRRPSGSE
VQSPVRQQQSRDGSTGPSEQRKLGAVPPLAPPSVNGGFKTPPTSGPQEASVPSSNQTQAGPGAPTSKLPRAAATM
SPTTGMAPPQGPPPSRPPADPASSGRVRGMSVDRSGTSGSPRLRSAQSPVARDGGLDMDTAAVNGRRTPTQTVKK
GHEPEATAATVTAAAVAADVAAKSKQPRHNPSQGSVDSTTDQSLKAPRPSSPPPPSRQTGTPSRRLSGRNSQTVA
LLKELDSSRNRNAWYASELELARKAGYVTTTGLSPALDAKATETFDDEDRPLVEALLAMRTELANVQSAVDKQAV
IAAKQIAEAEKQRDAAIQEAVYAKAKFAAHGVNMNSTSQHESERRGDAGDRTAEMSRKLATALNLQRDMQSQLEG
MRMELEAERRARKLADETTTAAQKRMTDLENYKQQTSTEVERLKAELHMVQREAREQSVSSAEAVAALELLRVEK
AEMTSKYDRALDSSKDHGETFESLRSAIVASQDARAHLEKKAEDERLEREALQERFNKLKAEHDACVAELGTATQ
RLKDAEELAKKHIEEARTHRQAVISGLDKISARDIPRSGQADSERLTALQNQIATSNGLVKKYKAEADSAADKLR
SAEERIAGLEQYQEQSSREGVAIRRQLQSSLREVQSLQAAQADVKNQLAAQQLEANAMTVQNKALKAILGERGIS
PTTAVRTRALASPRMASPDMGRVRELESQLASTVAAHEETKQTFASQAQESETAYREKLSQLESDYQSAVHYVKG
TEKMLKQLKDQLTRYKTDNGKLKAEIEELEARLDKDQGDTTAEWESERSKMRKRTEELESELREAGAQLDKDLEK
LKTELAESKRQRDAAVKSSEEATRSLTSQRKDLEQLQSTNSLLEQRAAEAEQKVSLLLDQVENSVDNYRRRSRQV
ASLGSDSGPGANGLDLLNRGHNRTESSDTMGGYVGPVSSGHVHNHNHALEARNSAALDNLASELETLRSHWESTN
KSYRLSSNFDFDHAPAPAREADDATTAGSGLSKSLADWRKRLDTDDVAHNGVDKTHST*
Coding >Ophcf2|03447
ATGGCCTTCCTCTTCAAGTCAAAGAAGAGCCAGGACCGCGCCTTGTCGAGCCGCGATGGCAACTCGAGCTCGCAG
TCGTCCATCCCGCCCGTCAGCTCTCGCATCCCCCGCGATGAGAAGAACGCAGTGGCGCAACGAGGGACGCCTACG
GGAAGCCTCAACTCGGGCGACAACGACGTCTCTGCTGCCAGTCCCGATCATGGCCATACGCGCCGCGGTGGGAGC
GTCGACACGACCCAGCAGAGCGATTTACCCCTTCGAAATGGACCGCCGCCAACGAATCCAAATGCTTCGCTCTAT
CCATGGTCGCAACGCCGCTTGACCTACTCCTCATCCCATTCCAGCCCTTTTCCGCGATACGGTGCCGCCGTCAAT
GCGCTTTCTTCCAAGGAAGGCGACATTTACATGATGGGGGGCCTGATTAACAGTTCGACGGTCAAGGGCGACCTG
TGGCTGATTGAAGCTGGCGGAAGCATGAATTGCTATCCCCTCGCTACCACGGCCGAGGGACCTTGTCCGAGGGTG
GGACATGCCAGTTTGCTGGTCGGCAACGCCTTCATCGTTTACGGTGGCGATACCAAGATCAAAGACTCTGACGTC
CTCGACGAGACGCTATATCTGCTTAATACGTCCACGCGGAACTGGTCGCTGGCTCTTCCCGCTGGCCCTCGGCCC
GCTGGCCGCTATGGTCATTCGCTGAATATTTTAGGGTCCAAGATATACATCTTCGGTGGTCAGGTTGAGGGTTCA
TTCATGAACGACCTCTCCGCCTTTGACCTCAACCAGCTTCAGAAGCCCAGCAACCGATGGGAGATCTTGGTACCG
GGCGAGGCATCTCCCAAGGTCCCGGCTCCGCGGACGAACCACTCCATGGTCACGTACAACGATAGGATGTATCTG
TTCGGTGGCACCAACGGGTTCCAATGGTTCAACGATGTCTGGTGCTACGATCCGTCGCTCAACTCATGGACGCAG
CTCGATTGCATAGGTTACATCCCGGCCCCTCGCGAGGGACACGCGGCCGCTCTCGTCGACGATGTCATGTACGTC
TTTGGCGGCCGCACCGAAGAAGGCAGCGATCTGGGCGATCTCGCGGCATTCAGGATATCGTCGCGCCGATGGTAC
ACGTTCCAAAACATGGGCCCCTCTCCTTCGCCGCGGTCCGGTCATAGTATGACGACCGTGGGTAAATGGATTGTT
GTCCTGGGCGGCGAGCCCAGCGCTGCCGCCTCCACCATCAACGACCTCGGCATCCTCTATGTCTTGGATACGACT
AAGATTCGGTATCCCAATGATAGCCAGCAGAGCACGCAAAGGGCGGTTCAGGGCCGGCGCCCGAGCGGGAGCGAA
GTCCAGAGCCCCGTACGCCAGCAGCAGTCTCGGGACGGGTCGACGGGGCCGTCAGAACAGCGGAAACTGGGCGCT
GTGCCCCCTCTGGCCCCCCCTTCCGTCAATGGTGGATTTAAGACGCCTCCGACGAGCGGCCCTCAGGAAGCCAGC
GTTCCATCGTCAAACCAGACACAGGCGGGTCCCGGGGCGCCGACATCCAAGCTCCCGCGTGCCGCCGCGACCATG
AGCCCTACTACCGGCATGGCCCCTCCGCAAGGTCCGCCGCCGTCGAGGCCCCCGGCGGACCCGGCGAGCTCAGGG
CGAGTACGCGGCATGTCGGTCGATCGGAGCGGTACGTCGGGCTCGCCCCGGCTCAGGTCAGCTCAGTCTCCCGTG
GCCCGCGACGGTGGTCTCGACATGGACACCGCCGCCGTCAATGGCCGACGAACGCCGACGCAGACGGTCAAGAAA
GGCCACGAGCCAGAAGCTACGGCTGCCACGGTCACCGCAGCAGCCGTCGCCGCCGATGTCGCCGCCAAGTCGAAG
CAGCCTCGTCACAATCCGTCACAGGGCTCCGTTGATAGCACGACGGACCAGAGCCTGAAGGCGCCACGGCCGTCA
TCACCGCCTCCGCCGAGCCGACAGACGGGCACTCCCTCCAGACGACTGTCTGGGCGCAACTCGCAGACGGTGGCC
CTACTCAAGGAGCTCGACTCGTCCCGCAACAGGAACGCGTGGTACGCCTCGGAGCTGGAGTTGGCTCGGAAAGCA
GGCTACGTCACCACCACCGGCTTAAGCCCGGCGCTCGATGCCAAGGCAACCGAGACCTTTGACGACGAGGACCGT
CCTCTCGTCGAGGCCCTACTGGCGATGCGCACTGAGCTGGCCAACGTGCAGAGCGCCGTAGACAAGCAGGCCGTC
ATCGCTGCCAAGCAGATCGCCGAGGCCGAGAAGCAGCGAGACGCGGCCATTCAGGAGGCCGTCTACGCAAAGGCA
AAATTTGCCGCTCACGGCGTCAACATGAACAGCACTTCCCAGCACGAGAGCGAGCGCCGCGGCGACGCCGGCGAT
AGGACTGCTGAGATGAGCCGGAAGCTCGCTACGGCCCTGAATCTCCAAAGAGACATGCAGTCGCAGCTGGAGGGC
ATGAGGATGGAGCTCGAAGCCGAACGAAGGGCACGAAAACTCGCCGACGAGACGACGACGGCGGCTCAGAAGCGC
ATGACGGACCTGGAAAACTACAAGCAGCAGACGTCGACCGAAGTCGAGCGGTTGAAGGCGGAGCTGCACATGGTG
CAGCGTGAAGCTCGCGAGCAGTCCGTATCCAGCGCCGAGGCCGTGGCCGCTCTGGAGCTCCTGAGGGTCGAGAAG
GCGGAGATGACCAGCAAGTACGACAGGGCCTTGGACAGCTCCAAGGATCACGGCGAGACGTTCGAGTCCCTCCGA
AGCGCCATCGTGGCGTCGCAGGATGCCAGGGCGCACCTGGAGAAGAAGGCCGAGGATGAGCGGCTCGAGAGGGAG
GCCCTACAGGAAAGGTTTAACAAACTAAAGGCCGAGCACGACGCGTGCGTAGCAGAACTGGGGACGGCCACGCAG
CGGCTCAAAGACGCCGAAGAGCTGGCCAAGAAGCATATCGAGGAGGCCAGAACCCATCGGCAAGCCGTCATCTCT
GGCCTCGACAAGATCTCGGCCAGGGACATTCCGAGGTCGGGCCAGGCGGACAGCGAGCGTCTGACGGCGCTCCAA
AACCAGATCGCGACGTCCAACGGCCTGGTTAAGAAGTACAAGGCCGAGGCGGATTCGGCGGCCGACAAGCTGCGT
AGCGCCGAGGAGCGCATCGCCGGGCTGGAGCAGTACCAGGAGCAGTCGAGCAGGGAGGGCGTCGCGATACGGCGA
CAGCTGCAGTCGTCGCTACGGGAGGTTCAGAGCCTGCAGGCGGCGCAGGCCGATGTCAAGAACCAACTGGCGGCC
CAGCAGCTCGAGGCCAACGCCATGACCGTCCAGAACAAGGCGCTCAAGGCCATTCTCGGCGAGCGAGGCATCAGC
CCGACAACTGCGGTGCGGACGAGGGCCCTGGCCAGCCCCCGGATGGCGTCTCCGGACATGGGCCGAGTCCGAGAG
CTCGAATCGCAGCTCGCCAGCACCGTGGCGGCGCACGAGGAGACGAAGCAGACGTTTGCGTCGCAGGCTCAGGAA
TCCGAGACGGCCTATCGCGAGAAGCTGTCGCAGCTCGAGAGCGACTATCAGTCAGCCGTGCACTACGTCAAGGGG
ACGGAGAAGATGCTGAAGCAGCTCAAGGATCAGCTAACACGTTACAAGACGGACAACGGGAAGCTCAAGGCCGAG
ATCGAAGAGCTCGAGGCTCGGCTCGACAAGGACCAAGGCGATACGACGGCCGAGTGGGAAAGCGAACGCAGCAAG
ATGCGAAAGAGAACGGAAGAGCTCGAGAGCGAACTGCGAGAAGCCGGCGCCCAGCTGGACAAGGACCTGGAGAAG
CTGAAGACGGAGCTGGCCGAGAGCAAGCGGCAGCGTGACGCGGCCGTCAAGAGCAGCGAGGAGGCGACCAGGAGT
CTCACCTCGCAGCGCAAGGACCTGGAGCAACTCCAGTCTACCAACTCGCTGCTGGAGCAACGGGCAGCCGAGGCG
GAGCAAAAGGTCTCCCTCCTACTGGACCAGGTCGAGAACTCGGTCGACAACTACCGCCGCCGAAGCCGACAGGTA
GCCAGCCTCGGCTCCGACTCCGGCCCGGGAGCCAACGGCCTCGACCTCCTCAACCGGGGCCACAACCGGACGGAG
AGCTCCGACACGATGGGCGGCTACGTCGGACCCGTCAGCAGCGGCCACGTCCACAACCACAACCACGCCCTGGAA
GCCCGCAACAGCGCCGCCCTCGATAACCTGGCCTCGGAGCTGGAAACGCTCCGCTCCCACTGGGAATCGACCAAC
AAGAGCTACAGGCTCTCGTCAAACTTCGACTTCGACCACGCGCCGGCCCCAGCCCGCGAAGCAGACGACGCCACC
ACCGCCGGCTCCGGTCTCAGCAAGAGCCTCGCCGACTGGAGGAAGAGGCTTGATACCGACGACGTGGCTCATAAT
GGCGTCGATAAGACGCACTCTACCTAA
Transcript >Ophcf2|03447
ATGGCCTTCCTCTTCAAGTCAAAGAAGAGCCAGGACCGCGCCTTGTCGAGCCGCGATGGCAACTCGAGCTCGCAG
TCGTCCATCCCGCCCGTCAGCTCTCGCATCCCCCGCGATGAGAAGAACGCAGTGGCGCAACGAGGGACGCCTACG
GGAAGCCTCAACTCGGGCGACAACGACGTCTCTGCTGCCAGTCCCGATCATGGCCATACGCGCCGCGGTGGGAGC
GTCGACACGACCCAGCAGAGCGATTTACCCCTTCGAAATGGACCGCCGCCAACGAATCCAAATGCTTCGCTCTAT
CCATGGTCGCAACGCCGCTTGACCTACTCCTCATCCCATTCCAGCCCTTTTCCGCGATACGGTGCCGCCGTCAAT
GCGCTTTCTTCCAAGGAAGGCGACATTTACATGATGGGGGGCCTGATTAACAGTTCGACGGTCAAGGGCGACCTG
TGGCTGATTGAAGCTGGCGGAAGCATGAATTGCTATCCCCTCGCTACCACGGCCGAGGGACCTTGTCCGAGGGTG
GGACATGCCAGTTTGCTGGTCGGCAACGCCTTCATCGTTTACGGTGGCGATACCAAGATCAAAGACTCTGACGTC
CTCGACGAGACGCTATATCTGCTTAATACGTCCACGCGGAACTGGTCGCTGGCTCTTCCCGCTGGCCCTCGGCCC
GCTGGCCGCTATGGTCATTCGCTGAATATTTTAGGGTCCAAGATATACATCTTCGGTGGTCAGGTTGAGGGTTCA
TTCATGAACGACCTCTCCGCCTTTGACCTCAACCAGCTTCAGAAGCCCAGCAACCGATGGGAGATCTTGGTACCG
GGCGAGGCATCTCCCAAGGTCCCGGCTCCGCGGACGAACCACTCCATGGTCACGTACAACGATAGGATGTATCTG
TTCGGTGGCACCAACGGGTTCCAATGGTTCAACGATGTCTGGTGCTACGATCCGTCGCTCAACTCATGGACGCAG
CTCGATTGCATAGGTTACATCCCGGCCCCTCGCGAGGGACACGCGGCCGCTCTCGTCGACGATGTCATGTACGTC
TTTGGCGGCCGCACCGAAGAAGGCAGCGATCTGGGCGATCTCGCGGCATTCAGGATATCGTCGCGCCGATGGTAC
ACGTTCCAAAACATGGGCCCCTCTCCTTCGCCGCGGTCCGGTCATAGTATGACGACCGTGGGTAAATGGATTGTT
GTCCTGGGCGGCGAGCCCAGCGCTGCCGCCTCCACCATCAACGACCTCGGCATCCTCTATGTCTTGGATACGACT
AAGATTCGGTATCCCAATGATAGCCAGCAGAGCACGCAAAGGGCGGTTCAGGGCCGGCGCCCGAGCGGGAGCGAA
GTCCAGAGCCCCGTACGCCAGCAGCAGTCTCGGGACGGGTCGACGGGGCCGTCAGAACAGCGGAAACTGGGCGCT
GTGCCCCCTCTGGCCCCCCCTTCCGTCAATGGTGGATTTAAGACGCCTCCGACGAGCGGCCCTCAGGAAGCCAGC
GTTCCATCGTCAAACCAGACACAGGCGGGTCCCGGGGCGCCGACATCCAAGCTCCCGCGTGCCGCCGCGACCATG
AGCCCTACTACCGGCATGGCCCCTCCGCAAGGTCCGCCGCCGTCGAGGCCCCCGGCGGACCCGGCGAGCTCAGGG
CGAGTACGCGGCATGTCGGTCGATCGGAGCGGTACGTCGGGCTCGCCCCGGCTCAGGTCAGCTCAGTCTCCCGTG
GCCCGCGACGGTGGTCTCGACATGGACACCGCCGCCGTCAATGGCCGACGAACGCCGACGCAGACGGTCAAGAAA
GGCCACGAGCCAGAAGCTACGGCTGCCACGGTCACCGCAGCAGCCGTCGCCGCCGATGTCGCCGCCAAGTCGAAG
CAGCCTCGTCACAATCCGTCACAGGGCTCCGTTGATAGCACGACGGACCAGAGCCTGAAGGCGCCACGGCCGTCA
TCACCGCCTCCGCCGAGCCGACAGACGGGCACTCCCTCCAGACGACTGTCTGGGCGCAACTCGCAGACGGTGGCC
CTACTCAAGGAGCTCGACTCGTCCCGCAACAGGAACGCGTGGTACGCCTCGGAGCTGGAGTTGGCTCGGAAAGCA
GGCTACGTCACCACCACCGGCTTAAGCCCGGCGCTCGATGCCAAGGCAACCGAGACCTTTGACGACGAGGACCGT
CCTCTCGTCGAGGCCCTACTGGCGATGCGCACTGAGCTGGCCAACGTGCAGAGCGCCGTAGACAAGCAGGCCGTC
ATCGCTGCCAAGCAGATCGCCGAGGCCGAGAAGCAGCGAGACGCGGCCATTCAGGAGGCCGTCTACGCAAAGGCA
AAATTTGCCGCTCACGGCGTCAACATGAACAGCACTTCCCAGCACGAGAGCGAGCGCCGCGGCGACGCCGGCGAT
AGGACTGCTGAGATGAGCCGGAAGCTCGCTACGGCCCTGAATCTCCAAAGAGACATGCAGTCGCAGCTGGAGGGC
ATGAGGATGGAGCTCGAAGCCGAACGAAGGGCACGAAAACTCGCCGACGAGACGACGACGGCGGCTCAGAAGCGC
ATGACGGACCTGGAAAACTACAAGCAGCAGACGTCGACCGAAGTCGAGCGGTTGAAGGCGGAGCTGCACATGGTG
CAGCGTGAAGCTCGCGAGCAGTCCGTATCCAGCGCCGAGGCCGTGGCCGCTCTGGAGCTCCTGAGGGTCGAGAAG
GCGGAGATGACCAGCAAGTACGACAGGGCCTTGGACAGCTCCAAGGATCACGGCGAGACGTTCGAGTCCCTCCGA
AGCGCCATCGTGGCGTCGCAGGATGCCAGGGCGCACCTGGAGAAGAAGGCCGAGGATGAGCGGCTCGAGAGGGAG
GCCCTACAGGAAAGGTTTAACAAACTAAAGGCCGAGCACGACGCGTGCGTAGCAGAACTGGGGACGGCCACGCAG
CGGCTCAAAGACGCCGAAGAGCTGGCCAAGAAGCATATCGAGGAGGCCAGAACCCATCGGCAAGCCGTCATCTCT
GGCCTCGACAAGATCTCGGCCAGGGACATTCCGAGGTCGGGCCAGGCGGACAGCGAGCGTCTGACGGCGCTCCAA
AACCAGATCGCGACGTCCAACGGCCTGGTTAAGAAGTACAAGGCCGAGGCGGATTCGGCGGCCGACAAGCTGCGT
AGCGCCGAGGAGCGCATCGCCGGGCTGGAGCAGTACCAGGAGCAGTCGAGCAGGGAGGGCGTCGCGATACGGCGA
CAGCTGCAGTCGTCGCTACGGGAGGTTCAGAGCCTGCAGGCGGCGCAGGCCGATGTCAAGAACCAACTGGCGGCC
CAGCAGCTCGAGGCCAACGCCATGACCGTCCAGAACAAGGCGCTCAAGGCCATTCTCGGCGAGCGAGGCATCAGC
CCGACAACTGCGGTGCGGACGAGGGCCCTGGCCAGCCCCCGGATGGCGTCTCCGGACATGGGCCGAGTCCGAGAG
CTCGAATCGCAGCTCGCCAGCACCGTGGCGGCGCACGAGGAGACGAAGCAGACGTTTGCGTCGCAGGCTCAGGAA
TCCGAGACGGCCTATCGCGAGAAGCTGTCGCAGCTCGAGAGCGACTATCAGTCAGCCGTGCACTACGTCAAGGGG
ACGGAGAAGATGCTGAAGCAGCTCAAGGATCAGCTAACACGTTACAAGACGGACAACGGGAAGCTCAAGGCCGAG
ATCGAAGAGCTCGAGGCTCGGCTCGACAAGGACCAAGGCGATACGACGGCCGAGTGGGAAAGCGAACGCAGCAAG
ATGCGAAAGAGAACGGAAGAGCTCGAGAGCGAACTGCGAGAAGCCGGCGCCCAGCTGGACAAGGACCTGGAGAAG
CTGAAGACGGAGCTGGCCGAGAGCAAGCGGCAGCGTGACGCGGCCGTCAAGAGCAGCGAGGAGGCGACCAGGAGT
CTCACCTCGCAGCGCAAGGACCTGGAGCAACTCCAGTCTACCAACTCGCTGCTGGAGCAACGGGCAGCCGAGGCG
GAGCAAAAGGTCTCCCTCCTACTGGACCAGGTCGAGAACTCGGTCGACAACTACCGCCGCCGAAGCCGACAGGTA
GCCAGCCTCGGCTCCGACTCCGGCCCGGGAGCCAACGGCCTCGACCTCCTCAACCGGGGCCACAACCGGACGGAG
AGCTCCGACACGATGGGCGGCTACGTCGGACCCGTCAGCAGCGGCCACGTCCACAACCACAACCACGCCCTGGAA
GCCCGCAACAGCGCCGCCCTCGATAACCTGGCCTCGGAGCTGGAAACGCTCCGCTCCCACTGGGAATCGACCAAC
AAGAGCTACAGGCTCTCGTCAAACTTCGACTTCGACCACGCGCCGGCCCCAGCCCGCGAAGCAGACGACGCCACC
ACCGCCGGCTCCGGTCTCAGCAAGAGCCTCGCCGACTGGAGGAAGAGGCTTGATACCGACGACGTGGCTCATAAT
GGCGTCGATAAGACGCACTCTACCTAA
Gene >Ophcf2|03447
ATGGCCTTCCTCTTCAAGTCAAAGAAGAGCCAGGACCGCGCCTTGTCGAGCCGCGATGGCAACTCGAGCTCGCAG
TCGTCCATCCCGCCCGTCAGCTCTCGCATCCCCCGCGATGAGAAGAACGCAGTGGCGCAACGAGGGACGCCTACG
GGAAGCCTCAACTCGGGCGACAACGACGTCTCTGCTGCCAGTCCCGATCATGGCCATACGCGCCGCGGTGGGAGC
GTCGACACGACCCAGCAGAGCGATTTACCCGTCAGTGGCGCCCCCTCTCCTCTCCTCTCCTCTGTCCACTCTCCC
ATCTCCCCTCCCCTCCTCTCCGCCGTAAAAAAAAGCCTTCATGCTATGCTGTGTCCAGCCCCCCTCTTTAACCAT
GGCTCATCTTTCTGACTTGTGTTCCACAGCTTCGAAATGGACCGCCGCCAACGAATCCAAATGCTTCGCTCTATC
CATGGTCGCAACGCCGCTTGACCTACTCCTCATCCCATTCCAGCCCTTTTCCGCGATACGGTGCCGCCGTCAATG
CGCTTTCTTCCAAGGAAGGCGACATTTACATGATGGGGGGCCTGATTAACAGTTCGACGGTCAAGGGCGACCTGT
GGCTGATTGAAGCTGGCGGAAGCATGAATTGCTATCCCCTCGCTACCACGGCCGAGGGACCTTGTCCGAGGGTGG
GACATGCCAGTTTGCTGGTCGGCAACGCCTTCATCGTTTACGGTGGCGATACCAAGATCAAAGACTCTGACGTCC
TCGACGAGACGCTATATCTGCTTAATACGTGTAAGCATAGTATGTCGCAGTTCTGGCCGGCGCTGTCGACTGACA
TGGTCTCTTTTAGCCACGCGGAACTGGTCGCTGGCTCTTCCCGCTGGCCCTCGGCCCGCTGGCCGCTATGGTCAT
TCGCTGAATATTTTAGGGTCCAAGATATACATCTTCGGTGGTCAGGTTGAGGGTTCATTCATGAACGACCTCTCC
GCCTTTGACCTCAACCAGCTTCAGAAGCCCAGCAACCGATGGGAGATCTTGGTACCGGGCGAGGCATCTCCCAAG
GTCCCGGCTCCGCGGACGAACCACTCCATGGTCACGTACAACGATAGGATGTATCTGTAAGTTTTCGGAGATTGC
ACAGCTTCGCCCTCTTGACTGACCGTGTGCTACCTACCTAGGTTCGGTGGCACCAACGGGTTCCAATGGTTCAAC
GATGTCTGGTGCTACGATCCGTCGCTCAACTCATGGACGCAGCTCGATTGCATAGGTTACATCCCGGCCCCTCGC
GAGGGACACGCGGCCGCTCTCGTCGACGATGTCATGTACGTCTTTGGCGGCCGCACCGAAGAAGGCAGCGATCTG
GGCGATCTCGCGGCATTCAGGATATCGTCGCGCCGATGGTACACGTTCCAAAACATGGGCCCCTCTCCTTCGCCG
CGGTCCGGTCATAGTATGACGACCGTGGGTAAATGGATTGTTGTCCTGGGCGGCGAGCCCAGCGCTGCCGCCTCC
ACCATCAACGACCTCGGCATCCTCTATGTCTTGGATACGACTAAGATTCGGTATCCCAATGATAGCCAGCAGAGC
ACGCAAAGGGCGGTTCAGGGCCGGCGCCCGAGCGGGAGCGAAGTCCAGAGCCCCGTACGCCAGCAGCAGTCTCGG
GACGGGTCGACGGGGCCGTCAGAACAGCGGAAACTGGGCGCTGTGCCCCCTCTGGCCCCCCCTTCCGTCAATGGT
GGATTTAAGACGCCTCCGACGAGCGGCCCTCAGGAAGCCAGCGTTCCATCGTCAAACCAGACACAGGCGGGTCCC
GGGGCGCCGACATCCAAGCTCCCGCGTGCCGCCGCGACCATGAGCCCTACTACCGGCATGGCCCCTCCGCAAGGT
CCGCCGCCGTCGAGGCCCCCGGCGGACCCGGCGAGCTCAGGGCGAGTACGCGGCATGTCGGTCGATCGGAGCGGT
ACGTCGGGCTCGCCCCGGCTCAGGTCAGCTCAGTCTCCCGTGGCCCGCGACGGTGGTCTCGACATGGACACCGCC
GCCGTCAATGGCCGACGAACGCCGACGCAGACGGTCAAGAAAGGCCACGAGCCAGAAGCTACGGCTGCCACGGTC
ACCGCAGCAGCCGTCGCCGCCGATGTCGCCGCCAAGTCGAAGCAGCCTCGTCACAATCCGTCACAGGGCTCCGTT
GATAGCACGACGGACCAGAGCCTGAAGGCGCCACGGCCGTCATCACCGCCTCCGCCGAGCCGACAGACGGGCACT
CCCTCCAGACGACTGTCTGGGCGCAACTCGCAGACGGTGGCCCTACTCAAGGAGCTCGACTCGTCCCGCAACAGG
AACGCGTGGTACGCCTCGGAGCTGGAGTTGGCTCGGAAAGCAGGCTACGTCACCACCACCGGCTTAAGCCCGGCG
CTCGATGCCAAGGCAACCGAGACCTTTGACGACGAGGACCGTCCTCTCGTCGAGGCCCTACTGGCGATGCGCACT
GAGCTGGCCAACGTGCAGAGCGCCGTAGACAAGCAGGCCGTCATCGCTGCCAAGCAGATCGCCGAGGCCGAGAAG
CAGCGAGACGCGGCCATTCAGGAGGCCGTCTACGCAAAGGCAAAATTTGCCGCTCACGGCGTCAACATGAACAGC
ACTTCCCAGCACGAGAGCGAGCGCCGCGGCGACGCCGGCGATAGGACTGCTGAGATGAGCCGGAAGCTCGCTACG
GCCCTGAATCTCCAAAGAGACATGCAGTCGCAGCTGGAGGGCATGAGGATGGAGCTCGAAGCCGAACGAAGGGCA
CGAAAACTCGCCGACGAGACGACGACGGCGGCTCAGAAGCGCATGACGGACCTGGAAAACTACAAGCAGCAGACG
TCGACCGAAGTCGAGCGGTTGAAGGCGGAGCTGCACATGGTGCAGCGTGAAGCTCGCGAGCAGTCCGTATCCAGC
GCCGAGGCCGTGGCCGCTCTGGAGCTCCTGAGGGTCGAGAAGGCGGAGATGACCAGCAAGTACGACAGGGCCTTG
GACAGCTCCAAGGATCACGGCGAGACGTTCGAGTCCCTCCGAAGCGCCATCGTGGCGTCGCAGGATGCCAGGGCG
CACCTGGAGAAGAAGGCCGAGGATGAGCGGCTCGAGAGGGAGGCCCTACAGGAAAGGTTTAACAAACTAAAGGCC
GAGCACGACGCGTGCGTAGCAGAACTGGGGACGGCCACGCAGCGGCTCAAAGACGCCGAAGAGCTGGCCAAGAAG
CATATCGAGGAGGCCAGAACCCATCGGCAAGCCGTCATCTCTGGCCTCGACAAGATCTCGGCCAGGGACATTCCG
AGGTCGGGCCAGGCGGACAGCGAGCGTCTGACGGCGCTCCAAAACCAGATCGCGACGTCCAACGGCCTGGTTAAG
AAGTACAAGGCCGAGGCGGATTCGGCGGCCGACAAGCTGCGTAGCGCCGAGGAGCGCATCGCCGGGCTGGAGCAG
TACCAGGAGCAGTCGAGCAGGGAGGGCGTCGCGATACGGCGACAGCTGCAGTCGTCGCTACGGGAGGTTCAGAGC
CTGCAGGCGGCGCAGGCCGATGTCAAGAACCAACTGGCGGCCCAGCAGCTCGAGGCCAACGCCATGACCGTCCAG
AACAAGGCGCTCAAGGCCATTCTCGGCGAGCGAGGCATCAGCCCGACAACTGCGGTGCGGACGAGGGCCCTGGCC
AGCCCCCGGATGGCGTCTCCGGACATGGGCCGAGTCCGAGAGCTCGAATCGCAGCTCGCCAGCACCGTGGCGGCG
CACGAGGAGACGAAGCAGACGTTTGCGTCGCAGGCTCAGGAATCCGAGACGGCCTATCGCGAGAAGCTGTCGCAG
CTCGAGAGCGACTATCAGTCAGCCGTGCACTACGTCAAGGGGACGGAGAAGATGCTGAAGCAGCTCAAGGATCAG
CTAACACGTTACAAGACGGACAACGGGAAGCTCAAGGCCGAGATCGAAGAGCTCGAGGCTCGGCTCGACAAGGAC
CAAGGCGATACGACGGCCGAGTGGGAAAGCGAACGCAGCAAGATGCGAAAGAGAACGGAAGAGCTCGAGAGCGAA
CTGCGAGAAGCCGGCGCCCAGCTGGACAAGGACCTGGAGAAGCTGAAGACGGAGCTGGCCGAGAGCAAGCGGCAG
CGTGACGCGGCCGTCAAGAGCAGCGAGGAGGCGACCAGGAGTCTCACCTCGCAGCGCAAGGACCTGGAGCAACTC
CAGTCTACCAACTCGCTGCTGGAGCAACGGGCAGCCGAGGCGGAGCAAAAGGTCTCCCTCCTACTGGACCAGGTC
GAGAACTCGGTCGACAACTACCGCCGCCGAAGCCGACAGGTAGCCAGCCTCGGCTCCGACTCCGGCCCGGGAGCC
AACGGCCTCGACCTCCTCAACCGGGGCCACAACCGGACGGAGAGCTCCGACACGATGGGCGGCTACGTCGGACCC
GTCAGCAGCGGCCACGTCCACAACCACAACCACGCCCTGGAAGCCCGCAACAGCGCCGCCCTCGATAACCTGGCC
TCGGAGCTGGAAACGCTCCGCTCCCACTGGGAATCGACCAACAAGAGCTACAGGCTCTCGTCAAACTTCGACTTC
GACCACGCGCCGGCCCCAGCCCGCGAAGCAGACGACGCCACCACCGCCGGCTCCGGTCTCAGCAAGAGCCTCGCC
GACTGGAGGAAGAGGCTTGATACCGACGACGTGGCTCATAATGGCGTCGATAAGACGCACTCTACCTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail