Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03440
Gene name
Locationscaffold_03:2687569..2689414
Strand-
Gene length (bp)1845
Transcript length (bp)1575
Coding sequence length (bp)1575
Protein length (aa) 525

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02353 CMAS Mycolic acid cyclopropane synthetase 3.0E-63 198 475
PF08241 Methyltransf_11 Methyltransferase domain 2.9E-12 265 365
PF13649 Methyltransf_25 Methyltransferase domain 3.1E-11 265 362
PF13489 Methyltransf_23 Methyltransferase domain 2.0E-10 247 375

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0016740 transferase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 42 0.45

Transmembrane Domains

Domain # Start End Length
1 61 80 19
2 85 107 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03440
MSKPTSLNGSESEFEFVETPKASPPSIDKHDECGVRITKYPAIKNGPLPADGPGSDSFNNTAFFALLGGVPLYLA
WKVGGGVKTFLFFALIADIPLLAAWWLAISAISPRRNEKAKLPGRPVEFYLDFKKEADRAKYRGSNKIPLETFHE
MYFDGHVDFKGDCLDVMEYRHDWASFRFTIGLIKFFLLGMIPELIMHTRSQDEEQVRDHYDRGDDFYGWFLGPRM
IYTSGIISDTNKEESLEQLQDNKLAIVCEKIGLKSGEKMLDIGCGWGTLARFASENYGARVTGITLGRNQTAWGN
SAMRKAGVPEDQSKVLCMDYRDIPVPEGGYDKITCLEMAEHVGVRHFSGFLTQVYNMLDDDGVFFLQIAGLRKPW
QYEDLIWGLFMNKYVFPGADASTPLGWVVDKLEGAGFEIKGIDTIGVHYSATLWRWYRNWMANRERVEAKYGKRW
FRIWEYFLAYSTIAARQGTATCFQITLVKNINSTHRIEGIDTQFGLFGALGNCKANLQAWAAKNKMTSSTEFLS*
Coding >Ophcf2|03440
ATGTCGAAACCTACCAGCCTCAATGGCAGCGAGAGCGAGTTTGAATTTGTTGAGACGCCAAAGGCTTCGCCTCCG
TCGATTGACAAGCATGACGAGTGCGGCGTTCGCATCACAAAGTATCCCGCCATCAAGAATGGGCCCCTTCCCGCC
GACGGCCCCGGCTCCGACTCGTTCAACAACACGGCCTTCTTCGCCCTCCTCGGCGGAGTCCCCCTCTATCTCGCC
TGGAAGGTCGGAGGTGGCGTCAAGACGTTCCTCTTCTTCGCCCTCATTGCCGATATCCCCCTCCTGGCTGCCTGG
TGGCTCGCCATCTCCGCCATTAGCCCCCGCCGCAACGAAAAGGCTAAACTTCCGGGCCGTCCCGTCGAGTTCTAC
CTAGACTTTAAGAAGGAGGCCGACCGTGCCAAGTACCGCGGCTCCAACAAGATTCCCTTGGAGACCTTTCACGAG
ATGTACTTTGATGGCCACGTCGACTTCAAGGGCGATTGCCTCGATGTCATGGAGTATCGCCACGACTGGGCCAGC
TTCCGCTTCACAATCGGCCTCATCAAGTTTTTCCTCCTCGGCATGATTCCCGAGCTCATCATGCACACCCGCTCC
CAAGACGAGGAGCAGGTCCGCGACCACTACGACCGCGGCGACGACTTTTACGGCTGGTTCCTCGGCCCTCGCATG
ATTTACACGTCGGGCATCATCTCCGACACCAACAAGGAGGAGTCGCTGGAGCAGCTGCAGGACAACAAGCTGGCC
ATTGTGTGCGAAAAGATTGGTCTCAAGTCGGGCGAGAAGATGCTCGACATCGGCTGCGGCTGGGGCACGCTGGCC
CGCTTCGCCAGCGAAAACTACGGCGCGCGCGTCACGGGCATCACCCTCGGCCGCAACCAGACGGCCTGGGGCAAC
AGCGCCATGCGCAAGGCTGGCGTACCCGAGGACCAGAGCAAGGTTCTGTGCATGGACTACCGCGACATTCCCGTG
CCCGAGGGCGGCTACGACAAGATTACCTGCCTCGAGATGGCGGAGCACGTCGGCGTCCGTCACTTTTCCGGCTTC
CTCACGCAGGTCTACAACATGCTCGACGACGACGGTGTCTTCTTCCTGCAGATTGCCGGCCTGCGCAAGCCGTGG
CAGTACGAGGATCTCATCTGGGGCCTGTTCATGAACAAGTACGTCTTCCCCGGCGCCGACGCGTCGACGCCGCTC
GGCTGGGTCGTGGACAAGCTCGAGGGCGCCGGTTTCGAGATCAAAGGCATCGACACCATCGGAGTCCACTACTCG
GCCACGCTGTGGCGGTGGTACCGGAACTGGATGGCCAACCGCGAGAGGGTCGAGGCCAAGTACGGCAAGCGCTGG
TTCCGGATCTGGGAATACTTTCTCGCCTACTCGACCATTGCGGCGCGCCAGGGAACGGCCACGTGCTTCCAGATC
ACGCTGGTCAAGAACATCAACTCGACGCACCGCATTGAAGGCATCGACACGCAGTTTGGCCTTTTTGGCGCTCTC
GGGAACTGCAAGGCCAATCTGCAGGCGTGGGCGGCCAAGAACAAGATGACGTCTTCGACCGAGTTCCTGTCGTGA
Transcript >Ophcf2|03440
ATGTCGAAACCTACCAGCCTCAATGGCAGCGAGAGCGAGTTTGAATTTGTTGAGACGCCAAAGGCTTCGCCTCCG
TCGATTGACAAGCATGACGAGTGCGGCGTTCGCATCACAAAGTATCCCGCCATCAAGAATGGGCCCCTTCCCGCC
GACGGCCCCGGCTCCGACTCGTTCAACAACACGGCCTTCTTCGCCCTCCTCGGCGGAGTCCCCCTCTATCTCGCC
TGGAAGGTCGGAGGTGGCGTCAAGACGTTCCTCTTCTTCGCCCTCATTGCCGATATCCCCCTCCTGGCTGCCTGG
TGGCTCGCCATCTCCGCCATTAGCCCCCGCCGCAACGAAAAGGCTAAACTTCCGGGCCGTCCCGTCGAGTTCTAC
CTAGACTTTAAGAAGGAGGCCGACCGTGCCAAGTACCGCGGCTCCAACAAGATTCCCTTGGAGACCTTTCACGAG
ATGTACTTTGATGGCCACGTCGACTTCAAGGGCGATTGCCTCGATGTCATGGAGTATCGCCACGACTGGGCCAGC
TTCCGCTTCACAATCGGCCTCATCAAGTTTTTCCTCCTCGGCATGATTCCCGAGCTCATCATGCACACCCGCTCC
CAAGACGAGGAGCAGGTCCGCGACCACTACGACCGCGGCGACGACTTTTACGGCTGGTTCCTCGGCCCTCGCATG
ATTTACACGTCGGGCATCATCTCCGACACCAACAAGGAGGAGTCGCTGGAGCAGCTGCAGGACAACAAGCTGGCC
ATTGTGTGCGAAAAGATTGGTCTCAAGTCGGGCGAGAAGATGCTCGACATCGGCTGCGGCTGGGGCACGCTGGCC
CGCTTCGCCAGCGAAAACTACGGCGCGCGCGTCACGGGCATCACCCTCGGCCGCAACCAGACGGCCTGGGGCAAC
AGCGCCATGCGCAAGGCTGGCGTACCCGAGGACCAGAGCAAGGTTCTGTGCATGGACTACCGCGACATTCCCGTG
CCCGAGGGCGGCTACGACAAGATTACCTGCCTCGAGATGGCGGAGCACGTCGGCGTCCGTCACTTTTCCGGCTTC
CTCACGCAGGTCTACAACATGCTCGACGACGACGGTGTCTTCTTCCTGCAGATTGCCGGCCTGCGCAAGCCGTGG
CAGTACGAGGATCTCATCTGGGGCCTGTTCATGAACAAGTACGTCTTCCCCGGCGCCGACGCGTCGACGCCGCTC
GGCTGGGTCGTGGACAAGCTCGAGGGCGCCGGTTTCGAGATCAAAGGCATCGACACCATCGGAGTCCACTACTCG
GCCACGCTGTGGCGGTGGTACCGGAACTGGATGGCCAACCGCGAGAGGGTCGAGGCCAAGTACGGCAAGCGCTGG
TTCCGGATCTGGGAATACTTTCTCGCCTACTCGACCATTGCGGCGCGCCAGGGAACGGCCACGTGCTTCCAGATC
ACGCTGGTCAAGAACATCAACTCGACGCACCGCATTGAAGGCATCGACACGCAGTTTGGCCTTTTTGGCGCTCTC
GGGAACTGCAAGGCCAATCTGCAGGCGTGGGCGGCCAAGAACAAGATGACGTCTTCGACCGAGTTCCTGTCGTGA
Gene >Ophcf2|03440
ATGTCGAAACCTACCAGCCTCAATGGCAGCGAGAGCGAGTTTGAATTTGTTGAGACGCCAAAGGCTTCGCCTCCG
TCGATTGACAAGCATGACGAGTGCGGCGTTCGCATCACAAAGGTTCGCCTTGCTTTCTCCTGTTGCTCTCCATTC
TCGTCGTCTTCCTCCCTCCCGCTCTCCTCCTCCTCCTCCTCCTCCTCCTCCTCCTCCTCCCCTTTCTTCACCTCC
CCTACCAAATCCCTCCAGGAGTCTTCACACACGCTGACCTCGTCCAGTATCCCGCCATCAAGAATGGGCCCCTTC
CCGCCGACGGCCCCGGCTCCGACTCGTTCAACAACACGGCCTTCTTCGCCCTCCTCGGCGGAGTCCCCCTCTATC
TCGCCTGGAAGGTCGGAGGTGGCGTCAAGACGTTCCTCTTCTTCGCCCTCATTGCCGATATCCCCCTCCTGGCTG
CCTGGTGGCTCGCCATCTCCGCCATTAGCCCCCGCCGCAACGAAAAGGCTAAACTTCCGGGCCGTCCCGTCGAGT
TCTACCTAGACTTTAAGAAGGAGGCCGACCGTGCCAAGTACCGCGGCTCCAACAAGATTCCCTTGGAGACCTTTC
ACGAGATGTACTTTGATGGCCACGTCGACTTCAAGGGCGATTGCCTCGATGTCATGGAGTATCGCCACGACTGGG
CCAGCTTCCGCTTCACAATCGGCCTCATCAAGTTTTTCCTCCTCGGCATGATTCCCGAGCTCATCATGCACACCC
GCTCCCAAGGTATGTACTCTCCTCCGTGTTGCTTCGACGCCCGGCCAACCCGCGACGGAAGACGAGGAGCAGGTC
CGCGACCACTACGACCGCGGCGACGACTTTTACGGCTGGTTCCTCGGCCCTCGCATGATTTACACGTCGGGCATC
ATCTCCGACACCAACAAGGAGGAGTCGCTGGAGCAGCTGCAGGACAACAAGCTGGCCATTGTGTGCGAAAAGATT
GGTCTCAAGTCGGGCGAGAAGATGCTCGACATCGGCTGCGGCTGGGGCACGCTGGCCCGCTTCGCCAGCGAAAAC
TACGGCGCGCGCGTCACGGGCATCACCCTCGGCCGCAACCAGACGGCCTGGGGCAACAGCGCCATGCGCAAGGCT
GGCGTACCCGAGGACCAGAGCAAGGTTCTGTGCATGGACTACCGCGACATTCCCGTGCCCGAGGGCGGCTACGAC
AAGATTACCTGCCTCGAGATGGCGGAGCACGTCGGCGTCCGTCACTTTTCCGGCTTCCTCACGCAGGTCTACAAC
ATGCTCGACGACGACGGTGTCTTCTTCCTGCAGATTGCCGGCCTGCGCAAGCCGTGGCAGTACGAGGATCTCATC
TGGGGCCTGTTCATGAACAAGTACGTCTTCCCCGGCGCCGACGCGTCGACGCCGCTCGGCTGGGTCGTGGACAAG
CTCGAGGGCGCCGGTTTCGAGATCAAAGGCATCGACACCATCGGAGTCCACTACTCGGCCACGCTGTGGCGGTGG
TACCGGAACTGGATGGCCAACCGCGAGAGGGTCGAGGCCAAGTACGGCAAGCGCTGGTTCCGGGTGAGTCTTGAA
TCTCGGTGTTGCTTCTCATCTCGTATCTGGCGGCTGAAACGTTCGAGGCAGATCTGGGAATACTTTCTCGCCTAC
TCGACCATTGCGGCGCGCCAGGGAACGGCCACGTGCTTCCAGATCACGCTGGTCAAGAACATCAACTCGACGCAC
CGCATTGAAGGCATCGACACGCAGTTTGGCCTTTTTGGCGCTCTCGGGAACTGCAAGGCCAATCTGCAGGCGTGG
GCGGCCAAGAACAAGATGACGTCTTCGACCGAGTTCCTGTCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail