Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03438
Gene name
Locationscaffold_03:2680670..2685250
Strand+
Gene length (bp)4580
Transcript length (bp)2547
Coding sequence length (bp)2547
Protein length (aa) 849

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07281 INSIG Insulin-induced protein (INSIG) 2.1E-73 64 278
PF02190 LON_substr_bdg ATP-dependent protease La (LON) substrate-binding domain 1.1E-24 585 826
PF13923 zf-C3HC4_2 Zinc finger, C3HC4 type (RING finger) 1.1E-10 495 532
PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger) 2.4E-07 495 532
PF13920 zf-C3HC4_3 Zinc finger, C3HC4 type (RING finger) 2.4E-06 493 535
PF13639 zf-RING_2 Ring finger domain 1.2E-07 494 533
PF13445 zf-RING_UBOX RING-type zinc-finger 7.0E-07 495 519

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 62 0.45

Transmembrane Domains

Domain # Start End Length
1 57 79 22
2 100 122 22
3 149 166 17
4 171 193 22
5 582 604 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03438
MGIYAEDEAEGCDIDDSSWHLSPTRLQTVDDVTDQLTRLGSHAPRRKSLPSSSSSTTAFALTGRLALLFLLGSGY
GVLVTRLHGDDGYRAHVSDGIVKPGLSCNYLACWGALGVALGSLLPWFDKVWDDSLGVETGESSMRGLGPGTDWA
LVMRAIGAFAGIVFAIRKLSWVSTLQISATLALVNPLLWWLIDRSIVGLLLSSGVSVTGSALLLSVNPNMMPAPS
RALQLALAGRNVSASSSTRHGMPVASSQETVETGIWMLCVLFNSCVCFGNIGRSDADASLPPPAPPAGGEDQPML
DASVLREDPLANSGPTNSQARDIVRLFQCRVCSAPYEHIISLPCGGSICKTCMPVPFIRTGVSFPDSEHRREGFI
CPYEDCKKVHAVVDCSNDVILNKVAEIVHAEMERGNDDAARLELSVRIKLYDWSEDEPPSPIGGSLMGGSRLMAT
WALAAQRRLPYEADVLVYDEGQQNDECDDSVIGVLQKTLRAEMDCQICYSLLYDPLTAECGHTFCRSCLLRVFVI
NRRCPMCRRDLCIDPHLQPYVCPPNDRILEITETFWEDELMARGQAMVAEAGASDDYVLIPLFICGLVFPTMPLV
LNVFEEHYRVMIRRVIEGDMTFGVVMPRSPDHQGDADFYQFGTLMQIVDYQHLPDGRSLVESKGLSRFRVVTFSR
VDGYSVGKALRIDDVGLQQEEALELAEVGYDVSDSAAGRRNDAEMTDLTSTTSETSFWSSLCQFGSELPQSTHDL
HTMTTQSLARFVLGFVDRTKEKDLPWLTDRVIGTYGSCPTDPAAVPWWLGSTMPVPIEQRYELLNTHTVRDRLKI
CGWWILNVRDWSKRRPSPDCIFL*
Coding >Ophcf2|03438
ATGGGTATTTACGCCGAGGATGAGGCTGAAGGGTGCGATATCGATGACTCGTCTTGGCATCTGTCGCCCACGCGC
TTGCAGACGGTTGACGACGTGACGGATCAGCTTACACGCCTCGGCTCGCACGCTCCGCGACGCAAGTCTCTGCCA
TCTTCGTCCTCGTCGACCACGGCGTTTGCGCTGACGGGTCGTCTCGCGCTGTTGTTCCTGCTCGGTAGCGGATAT
GGTGTCTTGGTGACGCGGCTGCACGGTGACGATGGGTATCGCGCCCATGTGAGCGACGGGATTGTAAAGCCGGGA
CTCAGCTGCAACTACCTGGCCTGCTGGGGCGCTCTCGGCGTCGCGCTGGGATCGTTATTGCCCTGGTTCGACAAG
GTATGGGACGACAGTCTGGGGGTCGAGACGGGGGAATCGTCGATGCGAGGTCTCGGTCCGGGGACGGACTGGGCG
TTGGTGATGCGGGCTATCGGGGCCTTTGCCGGCATTGTCTTTGCCATTCGTAAGCTCTCTTGGGTATCGACGCTG
CAAATTTCGGCCACGTTGGCTCTCGTCAATCCGCTGCTGTGGTGGCTGATCGACCGGAGCATCGTCGGTTTACTC
CTCTCGTCCGGAGTGAGCGTCACGGGCTCGGCTCTGCTCCTCAGCGTGAATCCGAACATGATGCCCGCTCCCAGC
AGGGCCTTGCAGCTGGCCCTGGCGGGACGGAACGTATCGGCCTCGTCGTCTACGAGGCACGGGATGCCGGTGGCC
TCGAGCCAGGAGACGGTCGAGACGGGCATCTGGATGCTCTGCGTGCTGTTCAACAGCTGCGTTTGCTTCGGGAAC
ATCGGTCGGAGCGATGCGGACGCCTCGCTTCCTCCGCCGGCACCCCCCGCCGGCGGCGAGGACCAGCCGATGCTT
GACGCCTCTGTCCTTAGAGAGGATCCGCTGGCAAACTCGGGGCCTACTAACAGTCAAGCCCGCGATATAGTCCGC
CTCTTCCAATGTCGCGTCTGCTCGGCCCCCTACGAGCACATCATCAGCCTTCCCTGCGGTGGAAGCATCTGCAAG
ACCTGTATGCCCGTGCCCTTCATCCGCACGGGCGTCAGCTTTCCGGACTCGGAGCATCGACGCGAGGGCTTCATC
TGCCCCTATGAAGACTGCAAAAAGGTGCACGCCGTCGTCGACTGCAGCAATGACGTCATCCTCAACAAGGTGGCC
GAAATCGTCCATGCCGAGATGGAGCGCGGTAACGACGACGCGGCCAGACTCGAGTTGTCGGTTCGCATCAAGCTC
TACGATTGGAGTGAGGACGAGCCCCCTTCGCCCATAGGCGGCTCCCTCATGGGCGGCTCTCGCCTGATGGCCACC
TGGGCTTTGGCAGCCCAGAGAAGGCTACCCTACGAGGCCGACGTGCTCGTTTACGACGAGGGCCAGCAGAACGAC
GAGTGCGACGACAGCGTCATCGGAGTGCTGCAAAAGACGCTGCGCGCCGAGATGGACTGCCAGATCTGCTACTCG
CTCTTGTACGATCCCTTGACGGCAGAATGCGGCCACACCTTTTGTCGTTCCTGTCTTCTCCGCGTCTTCGTCATC
AACCGGCGCTGTCCCATGTGCCGGCGCGACCTCTGCATCGATCCTCACCTCCAGCCCTACGTCTGTCCGCCGAAT
GACCGCATCCTCGAGATCACCGAGACGTTCTGGGAAGACGAGTTGATGGCTCGGGGACAGGCCATGGTTGCCGAG
GCCGGGGCGTCTGATGATTACGTCCTCATCCCGCTCTTCATCTGCGGCCTGGTCTTTCCGACCATGCCCTTGGTT
CTCAACGTGTTCGAAGAGCACTACCGGGTCATGATTCGGCGCGTCATCGAGGGCGACATGACGTTTGGCGTCGTC
ATGCCGCGCTCGCCCGATCACCAAGGCGATGCCGACTTTTATCAGTTCGGCACCTTGATGCAGATAGTCGACTAC
CAACACTTGCCAGACGGCCGCAGCCTGGTCGAATCCAAAGGGCTGTCGCGCTTCCGCGTCGTGACCTTTTCACGC
GTCGACGGCTATTCGGTGGGAAAAGCGCTTCGCATCGACGACGTCGGCCTGCAGCAAGAGGAGGCCCTGGAGCTG
GCCGAAGTCGGTTACGACGTCAGCGACAGCGCCGCGGGGAGACGCAACGACGCCGAGATGACGGATCTCACCTCG
ACGACCAGCGAGACGTCGTTTTGGTCCTCGTTGTGCCAGTTCGGGTCGGAGCTGCCTCAGTCAACGCATGATCTT
CATACCATGACGACACAGAGCCTGGCGCGCTTCGTCCTCGGCTTCGTCGACAGGACCAAGGAGAAGGACCTGCCG
TGGCTGACGGATCGGGTCATCGGTACCTATGGCTCCTGTCCTACCGACCCAGCCGCCGTTCCGTGGTGGTTAGGC
AGTACGATGCCTGTCCCCATAGAACAGAGATACGAGCTGCTCAACACGCATACCGTCCGCGACCGGCTGAAGATT
TGCGGCTGGTGGATTCTAAACGTCAGGGACTGGTCCAAGAGGCGGCCTTCGCCGGATTGCATCTTCCTGTGA
Transcript >Ophcf2|03438
ATGGGTATTTACGCCGAGGATGAGGCTGAAGGGTGCGATATCGATGACTCGTCTTGGCATCTGTCGCCCACGCGC
TTGCAGACGGTTGACGACGTGACGGATCAGCTTACACGCCTCGGCTCGCACGCTCCGCGACGCAAGTCTCTGCCA
TCTTCGTCCTCGTCGACCACGGCGTTTGCGCTGACGGGTCGTCTCGCGCTGTTGTTCCTGCTCGGTAGCGGATAT
GGTGTCTTGGTGACGCGGCTGCACGGTGACGATGGGTATCGCGCCCATGTGAGCGACGGGATTGTAAAGCCGGGA
CTCAGCTGCAACTACCTGGCCTGCTGGGGCGCTCTCGGCGTCGCGCTGGGATCGTTATTGCCCTGGTTCGACAAG
GTATGGGACGACAGTCTGGGGGTCGAGACGGGGGAATCGTCGATGCGAGGTCTCGGTCCGGGGACGGACTGGGCG
TTGGTGATGCGGGCTATCGGGGCCTTTGCCGGCATTGTCTTTGCCATTCGTAAGCTCTCTTGGGTATCGACGCTG
CAAATTTCGGCCACGTTGGCTCTCGTCAATCCGCTGCTGTGGTGGCTGATCGACCGGAGCATCGTCGGTTTACTC
CTCTCGTCCGGAGTGAGCGTCACGGGCTCGGCTCTGCTCCTCAGCGTGAATCCGAACATGATGCCCGCTCCCAGC
AGGGCCTTGCAGCTGGCCCTGGCGGGACGGAACGTATCGGCCTCGTCGTCTACGAGGCACGGGATGCCGGTGGCC
TCGAGCCAGGAGACGGTCGAGACGGGCATCTGGATGCTCTGCGTGCTGTTCAACAGCTGCGTTTGCTTCGGGAAC
ATCGGTCGGAGCGATGCGGACGCCTCGCTTCCTCCGCCGGCACCCCCCGCCGGCGGCGAGGACCAGCCGATGCTT
GACGCCTCTGTCCTTAGAGAGGATCCGCTGGCAAACTCGGGGCCTACTAACAGTCAAGCCCGCGATATAGTCCGC
CTCTTCCAATGTCGCGTCTGCTCGGCCCCCTACGAGCACATCATCAGCCTTCCCTGCGGTGGAAGCATCTGCAAG
ACCTGTATGCCCGTGCCCTTCATCCGCACGGGCGTCAGCTTTCCGGACTCGGAGCATCGACGCGAGGGCTTCATC
TGCCCCTATGAAGACTGCAAAAAGGTGCACGCCGTCGTCGACTGCAGCAATGACGTCATCCTCAACAAGGTGGCC
GAAATCGTCCATGCCGAGATGGAGCGCGGTAACGACGACGCGGCCAGACTCGAGTTGTCGGTTCGCATCAAGCTC
TACGATTGGAGTGAGGACGAGCCCCCTTCGCCCATAGGCGGCTCCCTCATGGGCGGCTCTCGCCTGATGGCCACC
TGGGCTTTGGCAGCCCAGAGAAGGCTACCCTACGAGGCCGACGTGCTCGTTTACGACGAGGGCCAGCAGAACGAC
GAGTGCGACGACAGCGTCATCGGAGTGCTGCAAAAGACGCTGCGCGCCGAGATGGACTGCCAGATCTGCTACTCG
CTCTTGTACGATCCCTTGACGGCAGAATGCGGCCACACCTTTTGTCGTTCCTGTCTTCTCCGCGTCTTCGTCATC
AACCGGCGCTGTCCCATGTGCCGGCGCGACCTCTGCATCGATCCTCACCTCCAGCCCTACGTCTGTCCGCCGAAT
GACCGCATCCTCGAGATCACCGAGACGTTCTGGGAAGACGAGTTGATGGCTCGGGGACAGGCCATGGTTGCCGAG
GCCGGGGCGTCTGATGATTACGTCCTCATCCCGCTCTTCATCTGCGGCCTGGTCTTTCCGACCATGCCCTTGGTT
CTCAACGTGTTCGAAGAGCACTACCGGGTCATGATTCGGCGCGTCATCGAGGGCGACATGACGTTTGGCGTCGTC
ATGCCGCGCTCGCCCGATCACCAAGGCGATGCCGACTTTTATCAGTTCGGCACCTTGATGCAGATAGTCGACTAC
CAACACTTGCCAGACGGCCGCAGCCTGGTCGAATCCAAAGGGCTGTCGCGCTTCCGCGTCGTGACCTTTTCACGC
GTCGACGGCTATTCGGTGGGAAAAGCGCTTCGCATCGACGACGTCGGCCTGCAGCAAGAGGAGGCCCTGGAGCTG
GCCGAAGTCGGTTACGACGTCAGCGACAGCGCCGCGGGGAGACGCAACGACGCCGAGATGACGGATCTCACCTCG
ACGACCAGCGAGACGTCGTTTTGGTCCTCGTTGTGCCAGTTCGGGTCGGAGCTGCCTCAGTCAACGCATGATCTT
CATACCATGACGACACAGAGCCTGGCGCGCTTCGTCCTCGGCTTCGTCGACAGGACCAAGGAGAAGGACCTGCCG
TGGCTGACGGATCGGGTCATCGGTACCTATGGCTCCTGTCCTACCGACCCAGCCGCCGTTCCGTGGTGGTTAGGC
AGTACGATGCCTGTCCCCATAGAACAGAGATACGAGCTGCTCAACACGCATACCGTCCGCGACCGGCTGAAGATT
TGCGGCTGGTGGATTCTAAACGTCAGGGACTGGTCCAAGAGGCGGCCTTCGCCGGATTGCATCTTCCTGTGA
Gene >Ophcf2|03438
ATGGGTATTTACGCCGAGGATGAGGCTGAAGGGTGCGATATCGATGACTCGTCTTGGCATCTGTCGCCCACGCGC
TTGCAGACGGTTGACGACGTGACGGATCAGCTTACACGCCTCGGCTCGCACGCTCCGCGACGCAAGTCTCTGCCA
TCTTCGTCCTCGTCGACCACGGCGTTTGCGCTGACGGGTCGTCTCGCGCTGTTGTTCCTGCTCGGTAGCGGATAT
GGTGTCTTGGTGACGCGGCTGCACGGTGACGATGGGTATCGCGCCCATGTGAGCGACGGGATTGTAAAGCCGGGA
CTCAGCTGCAACTACCTGGCCTGCTGGGGCGCTCTCGGCGTCGCGCTGGGATCGTTATTGCCCTGGTTCGACAAG
GTATGGGACGACAGTCTGGGGGTCGAGACGGGGGAATCGTCGATGCGAGGTCTCGGTCCGGGGACGGACTGGGCG
TTGGTGATGCGGGCTATCGGGGCCTTTGCCGGCATTGTCTTTGCCATTGTGAGTCGTCGTCCATGTTGGTCGGGG
GGGGTTAGGATGTCGCTGACGAGGCGCGTCTTCAGCGTAAGCTCTCTTGGGTATCGACGCTGCAAATTTCGGCCA
CGTTGGCTCTCGTCAATCCGCTGCTGTGGTGGCTGATCGACCGGAGCATCGTCGGTTTACTCCTCTCGTCCGGAG
TGAGCGTCACGGGCTCGGCTCTGCTCCTCAGCGTGAATCCGAACATGATGCCCGCTCCCAGCAGGGCCTTGCAGC
TGGCCCTGGCGGGACGGAACGTATCGGCCTCGTCGTCTACGAGGCACGGGATGCCGGTGGCCTCGAGCCAGGAGA
CGGTCGAGACGGGCATCTGGATGCTCTGCGTGCTGTTCAACAGCTGCGTTTGCTTCGGGAACATCGGTCGTAGGT
TGGCTAGGAGTGAGAATGCTGGCGTCAGGGGACGATGGGGAGGTTTGCGATGAAGATGATGGGAGGGTTTGTCTG
CGTGCTTCCCTGGGGTGGGGGGGGGGATGAAGCTGCAAGTTTTCGTTTTGTTTTGTTTCCTTTCTTCTTTCTTTG
CGTAAGCGAGGGCATCGATTGGATCGGTTTAGTGCAGATTTAGCAGATACAGCGTTACAGGGGAACAGCACGGGT
GGGAGGGATGAGGCGCGATAAAATGGTTCGTGTTGTTATTCATCTACCTACGAGGGAGAGCGACGAGCTATGAGG
ATGAGGATGAGGATGAGGATGAGGATGAGGATGAGGATGAGGGTGAGAATGTAGTGTCAAAGAGGACAGGCGAGC
GTCTGGCGAGCGACTATTACTTCTAAATGTAGTTGTACGAATAGGCGAGCAAAGTAAATTCCACGGCGCAGGTGG
CGTGGGAGATGTAGAACTGACAGCGGTGCTATCGTCGATGACAACATGTGGTTGTCATGGATGGTCGAGACCGGT
TGGTCAAGGCAACGTCACACCAGCATGCACGGCGCGGCCAATGGATAAGACCCGGGGCGCAAACACGGGGCGCAA
ACATGGGGTTGAAGCTATGGTCAACAGCAAAGACGGGGGTTTGACGGGGGTTTGACGGGGGTTTGCGATGACGTC
GACGCCCGTTGTCGGTGTCATGGATGAATGTCGGTATCTGTCGACGGCTTCGGTCGACTTACACATGTAGGCACC
GACGGTGGATTCGGAAGAGGCTGGCATCGCTGACGCGACGTCGTCTGACCGGGATCGCAGATGAGCCTATGCGAT
CGCCTTGTTGCTTCATGACGACCACGCTTTCAGCCAAGGGCTCTGCAGCGCCAGCCTGCTTGGGGCAGGGATTAG
ACCAGCCGTCCCATGTCAGACAAGAACTGTGTCCGAGGTTCCTCGTCGCCGGCCAGGGAGCGGTCCGTGTACCTG
GATCTCACAGTGCGCGTCCGGCTCGGCGAACCGGGTCGCTGTAAGACGAAGCTCGTCGCAACTGTTTTGGGCTTG
GGCTCGAGACCAGCATCATTGATCTGCTGGCTGGAGGCCGTGCAGCGAGGCGGACCCGCAAAACCTGGGCGTCAT
GAGGCGTGGCCCCTGGCCTGCGGAAGGGAAGCCAGTTGGTTTTTATCATTATATGTATTCGTACATACATACCTA
CCTACATACATACATACGAATCTGGTGCTGAGGGAGAGCCTAGAGGGCATCTTGTTGTTCGTCGCTTCATCTTCG
GCTATACTTGGCTGACGCTGCTTGACAACGACATCGGACGCAGCTCGCCTCCATCCATCCATCTTCTTCTCCATC
CTCTCTCTCTCTCTCTCTACCTACCTTTCTCTCCAAAGACGGACGCAGTGGCAGCGGCGGAGACGATAGACGGAG
AATTTCGCTGCTTCTGGTTCCGATCCCCGATTTCCCTTCTTTGCCAGCGGGCGAGAGACAACCATCGAAAGCAGC
TCGCCTCGTCCTTCTCCACCTCTTCTCTCCCTCCCTCCCTCCCTCCCTACATACATACCTACCTACCACCTAACC
ACCTACTACCGACTACCTACTACCGACTACCTACTACCGACTACCGACTACCTACCTACTTACTGCCTTCCTCGA
CGTCATCAAAAGACACACTGGCAGCAGTGGAGACGATATACAGATCATCTCGCTGACAGCCCCCCCCCCCACAAC
TTCCGTTCTTTCTCCCCGCCAACACTCGAGAAGCAACATCGCCAGCAGCTCGCCTCGTCCAGCAGTCTTTTTTTT
CAACGCCCTTCATCCCTCCCTCCGCCTACCTCTTTTTTCTATTCCATCGGATTCATTCAGGAAAAGCAGGTTTTA
TAACCTCCCACCACACATCGCTTATGTCCACAGATCTGCCAGATGCGGACGCCTCGCTTCCTCCGCCGGCACCCC
CCGCCGGCGGCGAGGACCAGCCGATGCTTGACGCCTCTGTCCTTAGAGAGGATCCGCTGGCAAACTCGGGGCCTA
CTAACAGTCAAGCCCGCGATATAGTCCGCCTCTTCCAATGTCGCGTCTGCTCGGCCCCCTACGAGCACATCATCA
GCCTTCCCTGCGGTGGAAGCATCTGCAAGACCTGTATGCCCGTGCCCTTCATCCGCACGGGCGTCAGCTTTCCGG
ACTCGGAGCATCGACGCGAGGGCTTCATCTGCCCCTATGAAGACTGCAAAAAGGTGCACGCCGTCGTCGACTGCA
GCAATGACGTCATCCTCAACAAGGTGGCCGAAATCGTCCATGCCGAGATGGAGCGCGGTAACGACGACGCGGCCA
GACTCGAGTTGTCGGTTCGCATCAAGCTCTACGATTGGAGTGAGGACGAGCCCCCTTCGCCCATAGGCGGCTCCC
TCATGGGCGGCTCTCGCCTGATGGCCACCTGGGCTTTGGCAGCCCAGAGAAGGCTACCCTACGAGGCCGACGTGC
TCGTTTACGACGAGGGCCAGCAGAACGACGAGTGCGACGACAGCGTCATCGGAGTGCTGCAAAAGACGCTGCGCG
CCGAGATGGACTGCCAGATCTGCTACTCGCTCTTGTACGATCCCTTGACGGCAGAATGCGGCCACACCTTTTGTC
GTTCCTGTCTTCTCCGCGTCTTCGTCATCAACCGGCGCTGTCCCATGTGCCGGCGCGACCTCTGCATCGATCCTC
ACCTCCAGCCCTACGTCTGTCCGCCGAATGACCGCATCCTCGAGATCACCGAGACGTTCTGGGAAGACGAGTTGA
TGGCTCGGGGACAGGCCATGGTTGCCGAGGCCGGGGCGTCTGATGATTACGTCCTCATCCCGCTCTTCATCTGCG
GCCTGGTCTTTCCGACCATGCCCTTGGTTCTCAACGTGTTCGAAGAGCACTACCGGGTCATGATTCGGCGCGTCA
TCGAGGGCGACATGACGTTTGGCGTCGTCATGCCGCGCTCGCCCGATCACCAAGGCGATGCCGACTTTTATCAGT
TCGGCACCTTGATGCAGATAGTCGACTACCAACACTTGCCAGACGGCCGCAGCCTGGTCGAATCCAAAGGGCTGT
CGCGCTTCCGCGTCGTGACCTTTTCACGCGTCGACGGCTATTCGGTGGGAAAAGCGCTTCGCATCGACGACGTCG
GCCTGCAGCAAGAGGAGGCCCTGGAGCTGGCCGAAGTCGGTTACGACGTCAGCGACAGCGCCGCGGGGAGACGCA
ACGACGCCGAGATGACGGATCTCACCTCGACGACCAGCGAGACGTCGTTTTGGTCCTCGTTGTGCCAGTTCGGGT
CGGAGCTGCCTCAGTCAACGCATGATCTTCATACCATGACGACACAGAGCCTGGCGCGCTTCGTCCTCGGCTTCG
TCGACAGGACCAAGGAGAAGGACCTGCCGTGGCTGACGGATCGGGTCATCGGTACCTATGGCTCCTGTCCTACCG
ACCCAGCCGCCGTTCCGTGGTGGTTAGGCAGTACGATGCCTGTCCCCATAGAACAGAGATACGAGCTGCTCAACA
CGCATACCGTCCGCGACCGGCTGAAGATTTGCGGCTGGTGGATTCTAAACGTCAGGGACTGGTCCAAGAGGTGAG
TCCCCCTGAAGAACGGGTCGCCCCGGGCGGTGTGGTTGACAATGTTCAGGCGGCCTTCGCCGGATTGCATCTTCC
TGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail