Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03434
Gene name
Locationscaffold_03:2662348..2667859
Strand-
Gene length (bp)5511
Transcript length (bp)4359
Coding sequence length (bp)4359
Protein length (aa) 1453

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14479 HeLo Prion-inhibition and propagation 9.9E-36 8 218

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 31 0.5

Transmembrane Domains

Domain # Start End Length
1 705 727 22
2 747 766 19
3 776 795 19
4 836 858 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 7.65 3.94 11.36
Alive In ants, during behavior modification 22.29 12.62 31.96
Dead In ants, recently dead 49.70 26.25 73.16

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.000238 yes
Alive Dead 0.000238 yes
Dead Fungus 0.000238 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03434
MDPISIGGLAIGVASLGLQVYTGCIQGTYSIGFVRQAARYLNLRLRMEQQRLYAWSETSGLLDLDADNQDRVLNS
NLFSLHRQTILDLLVQVRCLFDDFTAHQRRHDNLRPVHDNDDVLETPDRDAKRANFPMSDRKRDFIRKAMAGLRD
KSQDAWLRLRWTSIDKEAFERLLAKFAALNDNMTDLLDHTLQLEIRQTVQHTNRAVLLLNRKITDLGHLVLALRS
QLDAGAATSIVSPASTVKREAAVNALLQLTELAKFKAFNETINPKAGVATRIDAVTAEFLQLAEPDLACHLRLDR
RRIQLDPAVDDVDEMPRCEAVLTTAIGGSETRKRVWIEWKDYDDAGTHRDSLSKADIVDRVRKLACLLHRSPKPD
AFRTPHCLGFFDKADDGVADADVDVLDRRLGLVFERPSGAGLHADLPPVSLHELLRDGGGRKPRVTERVRLAHAL
ANCVLYLHAVNWLHKGLRSHNVLFFRPRAGHVDLTQPYLSGFDFSRPGGSDEMTDAPGDDAEHDLYRHPLTQSNR
RGERERSKKSFDIYSLGVILVELAHWKTVDEVLTVDLRRARGNPEVARRVRERLLDDDSVAGVGAETGLRFEQAT
TTCLVGGAELGLQTGDDETRDEVAERLSTRYYEGVVKSMSNQSERMAYQRRMVACASDLLVVGDGTWDLSRNTFL
LPNLQGVNFDTMRYNGMGNRFGSLAQYHRIVLAHAILAALVFLLIVPTAIMTARFYAQRPGYAVVFHAQMQILAG
LMLLAVFILGYFAVGPSRSLTNPHHGIGVAIFVLFILQLVGGRLVRHIVKMRSLRIMIHQWCGRAIALLGIVQVP
LGLTLYGSPKYVFVLYTLWMIFLLLVYFALSYRSAGRRELYMSGGTAARSEAGHSRVTESEYLSNNPRSEPGSGP
FKWLGPLAALGGLALASGRNKERARSRSRSRARSRSYSRGPAGDVGHSRRGSESYLSDKETELTSPRTGRGAGGG
GGFSKLVGGAAAAFGVSKLVSGLTGRRRGGERDDDYSAVATDTPRRQRSGRGPLAPTASEFSSDYTDNYGRRLHD
GTNTSFLPPSANPPPPVAGEGRRPTTPRPMYARSAADHDESDYTSYVSPSRRASGDRSGGGFAKGLLSGLGAGWI
AKKMADRRDRREDARLRDEEEMRAGTHGSRYTGDGHPSPTRRSRLPTRRRTQTVSEVTESSVNIPPSAPQHGRSR
SNVEHVSMPPMPPDPDTPERRTSSRRRREGERAQAEAVARASDLAIHQGHAHSDARGAHLPSPQGGPLSVKLKMH
DDRDRNVTLRRLTEEEAARANRGHGGGHGESESSISGLESAGYGRRYRREPSQQGRMERAAERVAERKVRVVDEE
NHHLPPLSPPQPSFAKTARRNGGKDSAYYSGAGGGPSGAPPVVPSQTASSGGSPDSHATWSQMTPSPAAKMDSAE
DRRRRRRQERRAAASTTSRPSGQDMFE*
Coding >Ophcf2|03434
ATGGATCCCATCTCCATCGGTGGGCTCGCCATAGGCGTCGCCTCGCTTGGCCTTCAGGTCTATACCGGCTGCATC
CAAGGCACGTACAGCATCGGTTTCGTCCGTCAAGCAGCCCGATATCTCAATTTGCGCCTGCGCATGGAGCAGCAG
CGCCTGTACGCCTGGAGCGAGACGTCGGGCCTGCTCGATCTCGACGCAGATAATCAGGATCGTGTCTTGAACTCG
AACCTCTTCAGTCTCCATCGCCAGACCATTCTCGATCTTCTCGTTCAGGTCCGCTGCCTCTTCGACGACTTCACC
GCCCACCAGCGCAGGCACGATAACCTGCGTCCCGTCCACGATAACGACGACGTCCTCGAAACCCCCGATCGCGAC
GCCAAGCGTGCCAATTTCCCAATGTCGGACAGGAAGCGCGACTTCATCCGCAAGGCCATGGCTGGCCTGCGCGAC
AAGTCGCAAGATGCATGGCTACGACTGCGCTGGACCTCGATCGACAAGGAGGCCTTTGAGAGGCTACTCGCCAAG
TTTGCTGCTCTCAACGACAACATGACGGATCTTCTCGATCACACGCTCCAGCTTGAGATCCGTCAGACGGTTCAA
CACACCAACCGCGCCGTGCTCCTCCTCAATCGCAAGATCACCGACCTCGGTCACCTCGTTCTCGCCCTCAGGTCA
CAGCTTGATGCCGGCGCAGCAACCTCGATCGTCTCGCCCGCCTCTACGGTCAAGCGCGAGGCCGCCGTCAATGCG
CTATTGCAACTCACCGAGCTGGCCAAGTTCAAGGCCTTTAACGAAACCATCAATCCCAAGGCCGGTGTTGCGACC
CGCATTGACGCGGTCACGGCCGAGTTCTTGCAGCTGGCCGAGCCGGACCTGGCGTGTCATCTCCGGCTGGACCGC
CGCCGCATCCAGCTCGATCCGGCCGTAGATGACGTCGATGAGATGCCCCGGTGCGAGGCCGTATTGACGACGGCC
ATCGGAGGGAGCGAGACGAGAAAGCGGGTCTGGATCGAGTGGAAGGACTACGACGACGCCGGCACCCATCGGGAC
TCGCTGTCCAAGGCAGACATTGTCGACCGCGTGCGCAAGTTGGCCTGCCTGCTACACCGCAGCCCCAAGCCCGAT
GCCTTCCGGACGCCGCATTGCCTCGGCTTCTTCGACAAGGCCGACGATGGCGTGGCCGATGCTGACGTCGATGTG
CTCGACCGGCGGCTCGGCCTCGTCTTTGAGCGGCCCAGCGGCGCCGGCCTGCACGCCGACCTGCCGCCCGTGTCG
TTGCACGAGCTCCTACGCGATGGTGGCGGCCGCAAGCCGCGGGTCACGGAGCGTGTCAGGCTCGCACATGCCCTG
GCCAACTGCGTGCTCTATCTGCACGCCGTCAACTGGCTGCACAAGGGCCTACGCAGCCACAACGTGCTCTTCTTC
CGACCGCGCGCCGGCCACGTCGACTTGACACAGCCCTACCTCTCGGGCTTTGACTTTTCGCGGCCGGGCGGCTCG
GACGAGATGACGGACGCTCCGGGAGATGACGCCGAGCACGACTTGTACCGGCACCCGCTGACGCAGTCGAACCGG
CGCGGAGAGCGCGAGCGATCCAAGAAGAGCTTCGACATATACAGCCTGGGTGTCATCTTGGTGGAGCTGGCCCAC
TGGAAGACGGTGGACGAGGTGCTGACCGTCGACTTGCGGCGCGCAAGGGGCAATCCAGAGGTGGCCAGGCGTGTG
AGGGAGCGGCTGCTAGACGACGACAGTGTCGCCGGCGTCGGAGCCGAGACGGGGCTGAGGTTCGAGCAGGCGACG
ACGACCTGTCTAGTGGGCGGGGCCGAGTTGGGCCTGCAGACGGGCGACGATGAGACGAGAGACGAGGTAGCAGAG
AGGCTCTCGACGAGGTACTACGAGGGTGTGGTCAAGAGCATGTCCAACCAGAGCGAGCGGATGGCCTATCAGCGC
AGAATGGTTGCATGTGCCTCTGACTTGCTGGTTGTGGGCGATGGGACTTGGGATTTGTCGCGGAATACCTTTCTG
CTTCCCAATCTTCAGGGGGTCAACTTTGATACGATGCGGTATAATGGGATGGGCAATCGGTTCGGTTCGCTCGCT
CAGTATCATCGTATCGTTCTCGCCCACGCAATCCTCGCCGCTCTCGTCTTTCTCCTCATCGTGCCGACAGCCATC
ATGACGGCGCGTTTCTACGCCCAGAGACCGGGATACGCCGTCGTCTTTCACGCTCAGATGCAGATACTGGCCGGT
CTCATGCTGCTCGCCGTCTTTATTCTCGGCTACTTTGCCGTCGGACCGAGCCGGAGCCTGACGAATCCGCACCAC
GGCATCGGCGTCGCCATCTTCGTCCTCTTTATCCTTCAGCTGGTGGGCGGCCGTCTGGTGCGCCATATTGTCAAG
ATGCGGTCGCTACGCATCATGATTCATCAGTGGTGTGGCCGCGCCATTGCTCTTCTCGGCATCGTCCAGGTTCCT
CTCGGTCTCACCCTCTACGGCTCGCCGAAATACGTCTTTGTCCTATACACCCTATGGATGATCTTCCTGCTCCTC
GTCTACTTCGCTTTGAGTTACAGGTCGGCCGGTCGTCGCGAGCTGTATATGAGCGGAGGAACAGCCGCCCGGTCA
GAAGCCGGACACAGCAGAGTCACTGAGTCCGAATACTTGTCCAACAACCCCAGATCCGAGCCGGGAAGCGGTCCA
TTCAAGTGGCTCGGCCCGCTCGCTGCTCTCGGCGGCCTGGCACTAGCATCCGGTCGCAATAAGGAACGAGCGCGG
AGCCGCAGTCGGAGCCGCGCTAGGTCACGCTCGTATAGCAGAGGGCCGGCCGGTGACGTCGGTCATTCGAGACGC
GGCTCAGAGAGTTATCTCAGCGACAAGGAGACGGAGTTGACGTCGCCGAGGACCGGACGTGGAGCTGGTGGAGGC
GGGGGGTTCTCCAAGCTGGTCGGCGGCGCGGCTGCGGCTTTCGGCGTCTCTAAGCTCGTCTCCGGTCTGACGGGC
CGACGACGGGGTGGCGAACGGGATGACGACTACTCTGCTGTGGCAACGGACACTCCTCGGAGACAGCGGTCTGGA
CGCGGTCCCCTTGCTCCGACGGCCAGCGAGTTTAGCAGCGACTATACCGACAACTACGGCCGTCGCCTACATGAC
GGCACCAACACGTCTTTTCTACCGCCGTCGGCGAATCCTCCGCCGCCTGTGGCCGGAGAAGGACGTCGTCCAACG
ACGCCTCGGCCCATGTACGCTCGCAGCGCCGCAGATCATGACGAGAGCGACTACACGTCCTACGTCAGCCCGTCT
CGACGCGCGTCAGGGGATCGATCGGGAGGCGGCTTTGCCAAGGGTCTGCTATCTGGCCTCGGAGCTGGCTGGATC
GCAAAGAAGATGGCCGACAGGCGGGATAGGAGGGAAGATGCGAGGCTACGAGACGAGGAGGAAATGAGAGCCGGG
ACGCATGGCTCTCGGTACACGGGCGATGGACATCCGTCGCCGACCAGACGAAGCCGGCTACCGACCAGGCGGAGA
ACACAGACCGTATCCGAGGTGACGGAGTCGTCCGTCAACATCCCGCCGTCTGCGCCTCAGCACGGGCGCTCACGA
TCCAACGTCGAGCACGTCTCCATGCCGCCGATGCCGCCAGATCCAGATACCCCCGAGCGACGGACATCATCGCGG
AGACGGCGAGAAGGAGAGCGAGCGCAGGCAGAAGCAGTGGCGCGGGCTAGCGACCTCGCCATTCACCAGGGCCAT
GCGCACAGCGACGCGAGGGGGGCGCATCTGCCATCGCCGCAGGGCGGGCCGCTGAGCGTCAAGCTCAAGATGCAC
GACGACCGGGACCGCAACGTGACGCTCCGGCGACTCACGGAGGAGGAGGCGGCGCGGGCGAATCGCGGTCATGGA
GGCGGCCACGGAGAGTCGGAGAGCAGCATCTCCGGGCTCGAGTCGGCGGGCTACGGCCGGCGATATCGGCGCGAG
CCCAGCCAGCAGGGACGCATGGAGCGGGCGGCCGAAAGAGTGGCCGAGCGAAAGGTTAGAGTCGTCGACGAGGAG
AACCATCACCTGCCTCCGCTCTCTCCACCACAGCCATCGTTTGCGAAGACGGCGAGGCGCAACGGCGGCAAGGAC
TCGGCTTACTACTCGGGGGCCGGAGGAGGGCCATCGGGGGCGCCTCCGGTCGTCCCGTCACAGACTGCCTCTAGC
GGAGGGAGCCCAGACAGCCACGCGACATGGAGTCAGATGACTCCTTCGCCGGCTGCGAAGATGGACTCGGCTGAG
GATAGGCGGAGGAGGCGGAGACAGGAGCGGAGGGCGGCGGCGAGCACGACGAGCAGGCCTTCGGGGCAGGACATG
TTTGAGTGA
Transcript >Ophcf2|03434
ATGGATCCCATCTCCATCGGTGGGCTCGCCATAGGCGTCGCCTCGCTTGGCCTTCAGGTCTATACCGGCTGCATC
CAAGGCACGTACAGCATCGGTTTCGTCCGTCAAGCAGCCCGATATCTCAATTTGCGCCTGCGCATGGAGCAGCAG
CGCCTGTACGCCTGGAGCGAGACGTCGGGCCTGCTCGATCTCGACGCAGATAATCAGGATCGTGTCTTGAACTCG
AACCTCTTCAGTCTCCATCGCCAGACCATTCTCGATCTTCTCGTTCAGGTCCGCTGCCTCTTCGACGACTTCACC
GCCCACCAGCGCAGGCACGATAACCTGCGTCCCGTCCACGATAACGACGACGTCCTCGAAACCCCCGATCGCGAC
GCCAAGCGTGCCAATTTCCCAATGTCGGACAGGAAGCGCGACTTCATCCGCAAGGCCATGGCTGGCCTGCGCGAC
AAGTCGCAAGATGCATGGCTACGACTGCGCTGGACCTCGATCGACAAGGAGGCCTTTGAGAGGCTACTCGCCAAG
TTTGCTGCTCTCAACGACAACATGACGGATCTTCTCGATCACACGCTCCAGCTTGAGATCCGTCAGACGGTTCAA
CACACCAACCGCGCCGTGCTCCTCCTCAATCGCAAGATCACCGACCTCGGTCACCTCGTTCTCGCCCTCAGGTCA
CAGCTTGATGCCGGCGCAGCAACCTCGATCGTCTCGCCCGCCTCTACGGTCAAGCGCGAGGCCGCCGTCAATGCG
CTATTGCAACTCACCGAGCTGGCCAAGTTCAAGGCCTTTAACGAAACCATCAATCCCAAGGCCGGTGTTGCGACC
CGCATTGACGCGGTCACGGCCGAGTTCTTGCAGCTGGCCGAGCCGGACCTGGCGTGTCATCTCCGGCTGGACCGC
CGCCGCATCCAGCTCGATCCGGCCGTAGATGACGTCGATGAGATGCCCCGGTGCGAGGCCGTATTGACGACGGCC
ATCGGAGGGAGCGAGACGAGAAAGCGGGTCTGGATCGAGTGGAAGGACTACGACGACGCCGGCACCCATCGGGAC
TCGCTGTCCAAGGCAGACATTGTCGACCGCGTGCGCAAGTTGGCCTGCCTGCTACACCGCAGCCCCAAGCCCGAT
GCCTTCCGGACGCCGCATTGCCTCGGCTTCTTCGACAAGGCCGACGATGGCGTGGCCGATGCTGACGTCGATGTG
CTCGACCGGCGGCTCGGCCTCGTCTTTGAGCGGCCCAGCGGCGCCGGCCTGCACGCCGACCTGCCGCCCGTGTCG
TTGCACGAGCTCCTACGCGATGGTGGCGGCCGCAAGCCGCGGGTCACGGAGCGTGTCAGGCTCGCACATGCCCTG
GCCAACTGCGTGCTCTATCTGCACGCCGTCAACTGGCTGCACAAGGGCCTACGCAGCCACAACGTGCTCTTCTTC
CGACCGCGCGCCGGCCACGTCGACTTGACACAGCCCTACCTCTCGGGCTTTGACTTTTCGCGGCCGGGCGGCTCG
GACGAGATGACGGACGCTCCGGGAGATGACGCCGAGCACGACTTGTACCGGCACCCGCTGACGCAGTCGAACCGG
CGCGGAGAGCGCGAGCGATCCAAGAAGAGCTTCGACATATACAGCCTGGGTGTCATCTTGGTGGAGCTGGCCCAC
TGGAAGACGGTGGACGAGGTGCTGACCGTCGACTTGCGGCGCGCAAGGGGCAATCCAGAGGTGGCCAGGCGTGTG
AGGGAGCGGCTGCTAGACGACGACAGTGTCGCCGGCGTCGGAGCCGAGACGGGGCTGAGGTTCGAGCAGGCGACG
ACGACCTGTCTAGTGGGCGGGGCCGAGTTGGGCCTGCAGACGGGCGACGATGAGACGAGAGACGAGGTAGCAGAG
AGGCTCTCGACGAGGTACTACGAGGGTGTGGTCAAGAGCATGTCCAACCAGAGCGAGCGGATGGCCTATCAGCGC
AGAATGGTTGCATGTGCCTCTGACTTGCTGGTTGTGGGCGATGGGACTTGGGATTTGTCGCGGAATACCTTTCTG
CTTCCCAATCTTCAGGGGGTCAACTTTGATACGATGCGGTATAATGGGATGGGCAATCGGTTCGGTTCGCTCGCT
CAGTATCATCGTATCGTTCTCGCCCACGCAATCCTCGCCGCTCTCGTCTTTCTCCTCATCGTGCCGACAGCCATC
ATGACGGCGCGTTTCTACGCCCAGAGACCGGGATACGCCGTCGTCTTTCACGCTCAGATGCAGATACTGGCCGGT
CTCATGCTGCTCGCCGTCTTTATTCTCGGCTACTTTGCCGTCGGACCGAGCCGGAGCCTGACGAATCCGCACCAC
GGCATCGGCGTCGCCATCTTCGTCCTCTTTATCCTTCAGCTGGTGGGCGGCCGTCTGGTGCGCCATATTGTCAAG
ATGCGGTCGCTACGCATCATGATTCATCAGTGGTGTGGCCGCGCCATTGCTCTTCTCGGCATCGTCCAGGTTCCT
CTCGGTCTCACCCTCTACGGCTCGCCGAAATACGTCTTTGTCCTATACACCCTATGGATGATCTTCCTGCTCCTC
GTCTACTTCGCTTTGAGTTACAGGTCGGCCGGTCGTCGCGAGCTGTATATGAGCGGAGGAACAGCCGCCCGGTCA
GAAGCCGGACACAGCAGAGTCACTGAGTCCGAATACTTGTCCAACAACCCCAGATCCGAGCCGGGAAGCGGTCCA
TTCAAGTGGCTCGGCCCGCTCGCTGCTCTCGGCGGCCTGGCACTAGCATCCGGTCGCAATAAGGAACGAGCGCGG
AGCCGCAGTCGGAGCCGCGCTAGGTCACGCTCGTATAGCAGAGGGCCGGCCGGTGACGTCGGTCATTCGAGACGC
GGCTCAGAGAGTTATCTCAGCGACAAGGAGACGGAGTTGACGTCGCCGAGGACCGGACGTGGAGCTGGTGGAGGC
GGGGGGTTCTCCAAGCTGGTCGGCGGCGCGGCTGCGGCTTTCGGCGTCTCTAAGCTCGTCTCCGGTCTGACGGGC
CGACGACGGGGTGGCGAACGGGATGACGACTACTCTGCTGTGGCAACGGACACTCCTCGGAGACAGCGGTCTGGA
CGCGGTCCCCTTGCTCCGACGGCCAGCGAGTTTAGCAGCGACTATACCGACAACTACGGCCGTCGCCTACATGAC
GGCACCAACACGTCTTTTCTACCGCCGTCGGCGAATCCTCCGCCGCCTGTGGCCGGAGAAGGACGTCGTCCAACG
ACGCCTCGGCCCATGTACGCTCGCAGCGCCGCAGATCATGACGAGAGCGACTACACGTCCTACGTCAGCCCGTCT
CGACGCGCGTCAGGGGATCGATCGGGAGGCGGCTTTGCCAAGGGTCTGCTATCTGGCCTCGGAGCTGGCTGGATC
GCAAAGAAGATGGCCGACAGGCGGGATAGGAGGGAAGATGCGAGGCTACGAGACGAGGAGGAAATGAGAGCCGGG
ACGCATGGCTCTCGGTACACGGGCGATGGACATCCGTCGCCGACCAGACGAAGCCGGCTACCGACCAGGCGGAGA
ACACAGACCGTATCCGAGGTGACGGAGTCGTCCGTCAACATCCCGCCGTCTGCGCCTCAGCACGGGCGCTCACGA
TCCAACGTCGAGCACGTCTCCATGCCGCCGATGCCGCCAGATCCAGATACCCCCGAGCGACGGACATCATCGCGG
AGACGGCGAGAAGGAGAGCGAGCGCAGGCAGAAGCAGTGGCGCGGGCTAGCGACCTCGCCATTCACCAGGGCCAT
GCGCACAGCGACGCGAGGGGGGCGCATCTGCCATCGCCGCAGGGCGGGCCGCTGAGCGTCAAGCTCAAGATGCAC
GACGACCGGGACCGCAACGTGACGCTCCGGCGACTCACGGAGGAGGAGGCGGCGCGGGCGAATCGCGGTCATGGA
GGCGGCCACGGAGAGTCGGAGAGCAGCATCTCCGGGCTCGAGTCGGCGGGCTACGGCCGGCGATATCGGCGCGAG
CCCAGCCAGCAGGGACGCATGGAGCGGGCGGCCGAAAGAGTGGCCGAGCGAAAGGTTAGAGTCGTCGACGAGGAG
AACCATCACCTGCCTCCGCTCTCTCCACCACAGCCATCGTTTGCGAAGACGGCGAGGCGCAACGGCGGCAAGGAC
TCGGCTTACTACTCGGGGGCCGGAGGAGGGCCATCGGGGGCGCCTCCGGTCGTCCCGTCACAGACTGCCTCTAGC
GGAGGGAGCCCAGACAGCCACGCGACATGGAGTCAGATGACTCCTTCGCCGGCTGCGAAGATGGACTCGGCTGAG
GATAGGCGGAGGAGGCGGAGACAGGAGCGGAGGGCGGCGGCGAGCACGACGAGCAGGCCTTCGGGGCAGGACATG
TTTGAGTGA
Gene >Ophcf2|03434
ATGGATCCCATCTCCATCGGTGGGCTCGCCATAGGCGTCGCCTCGCTTGGCCTTCAGGTCTATACCGGCTGCATC
CAAGGCACGTACAGCATCGGTTTCGTCCGTCAAGCAGCCCGGTAACGGCCCGCCAGCCATCCAGCTCCTCGTCAC
CGCTCTGGGCTACGACGATGAGTGCAGATATCTCAATTTGCGCCTGCGCATGGAGCAGCAGCGCCTGTACGCCTG
GAGCGAGACGTCGGGCCTGCTCGATCTCGACGCAGATAATCAGGATCGTGTCTTGAACTCGAACCTCTTCAGTCT
CCATCGCCAGACCATTCTCGATCTTCTCGTTCAGGTCCGCTGCCTCTTCGACGACTTCACCGCCCACCAGCGCAG
GCACGATAACCTGCGTCCCGTCCACGATAACGACGACGTCCTCGAAACCCCCGATCGCGACGCCAAGCGTGCCAA
TTTCCCAATGTCGGACAGGAAGCGCGACTTCATCCGCAAGGCCATGGCTGGCCTGCGCGACAAGTCGCAAGATGC
ATGGCTACGACTGCGCTGGACCTCGATCGACAAGGAGGCCTTTGAGAGGCTACTCGCCAAGTTTGCTGCTCTCAA
CGACAACATGACGGATCTTCTCGATCACACGCTCCAGCTTGAGATCCGTCAGACGGTTCAACACACCAACCGCGC
CGTGCTCCTCCTCAATCGCAAGATCACCGACCTCGGTCACCTCGTTCTCGCCCTCAGGTCACAGCTTGATGCCGG
CGCAGCAACCTCGATCGTCTCGCCCGCCTCTACGGTCAAGCGCGAGGCCGCCGTCAATGCGCTATTGCAACTCAC
CGAGCTGGCCAAGTTCAAGGCCTTTAACGAAACCATCAATCCCAAGGCCGGTGTTGCGACCCGCATTGACGCGGT
CACGGCCGAGTTCTTGCAGCTGGCCGAGCCGGACCTGGCGTGTCATCTCCGGCTGGACCGCCGCCGCATCCAGCT
CGATCCGGCCGTAGATGACGTCGATGAGATGCCCCGGTGCGAGGCCGTATTGACGACGGCCATCGGAGGGAGCGA
GACGAGAAAGCGGGTCTGGATCGAGTGGAAGGACTACGACGACGCCGGCACCCATCGGGACTCGCTGTCCAAGGC
AGACATTGTCGACCGCGTGCGCAAGTTGGCCTGCCTGCTACACCGCAGCCCCAAGCCCGATGCCTTCCGGACGCC
GCATTGCCTCGGCTTCTTCGACAAGGCCGACGATGGCGTGGCCGATGCTGACGTCGATGTGCTCGACCGGCGGCT
CGGCCTCGTCTTTGAGCGGCCCAGCGGCGCCGGCCTGCACGCCGACCTGCCGCCCGTGTCGTTGCACGAGCTCCT
ACGCGATGGTGGCGGCCGCAAGCCGCGGGTCACGGAGCGTGTCAGGCTCGCACATGCCCTGGCCAACTGCGTGCT
CTATCTGCACGCCGTCAACTGGCTGCACAAGGGCCTACGCAGCCACAACGTGCTCTTCTTCCGACCGCGCGCCGG
CCACGTCGACTTGACACAGCCCTACCTCTCGGGCTTTGACTTTTCGCGGCCGGGCGGCTCGGACGAGATGACGGA
CGCTCCGGGAGATGACGCCGAGCACGACTTGTACCGGCACCCGCTGACGCAGTCGAACCGGCGCGGAGAGCGCGA
GCGATCCAAGAAGAGCTTCGACATATACAGCCTGGGTGTCATCTTGGTGGAGCTGGCCCACTGGAAGACGGTGGA
CGAGGTGCTGACCGTCGACTTGCGGCGCGCAAGGGGCAATCCAGAGGTGGCCAGGCGTGTGAGGGAGCGGCTGCT
AGACGACGACAGTGTCGCCGGCGTCGGAGCCGAGACGGGGCTGAGGTTCGAGCAGGCGACGACGACCTGTCTAGT
GGGCGGGGCCGAGTTGGGCCTGCAGACGGGCGACGATGAGACGAGAGACGAGGTAGCAGAGAGGCTCTCGACGAG
GTACTACGAGGGTGTGGTCAAGAGGTTGGGGGAGATTGTCGTCTAGAGATTAGACGGACTCCGTGACTGCGCGAA
CACGAAGACGGGGCCAGCATGTCCAACCAGAGCGAGCGGATGGCCTATCAGCGCAGAATGGTTGCATGTGCGTGC
GTGTCTGCGTGCGTGCCGAAGAGGAGATGCGGGTGGTTCTGCCTCGATAGGACAAATTGCTATTGGTGAGGCGAG
TTGATGATTTTTTCCGCTTGTCCAAGCCTTTCTTCTTTTACACTGTTTTCCATTCGTATCCATGAATGTATCTGA
CCCCTTGCCGTCCTCCGTGACGCCGTTCTGACGCAGCTGACTGGTCAGAGCTGGATGAGGTAGAGGTCGGGGCTG
GAGGGACGAATGGGTGGTGGTATGCGGGGGACGTGCGTCATGTAGAGGCTGAGGCGTGGTTTCGTGTGCTGTCCC
GCGGCAGGGAAGTTGGCAGGTTCGAGCCAGCAGGAGCAGAGAAAGCAGGAGCAAGAAGGGAAGGACTTCGGAGCC
GGCGGTGACGCAATGACGCTCTGGTTGAAGGGGAGCTGATTGGTTGGACTCGCCATTGGAACTTCTCGTGTTGGG
TGCTGCGTTGGACGAGGCCTGAAATCATGAAAACAAGCCCGTCCTCGGCTGATCAATCCGAGGGCCCGGCCCGTA
GCCCCTCCCACCCCCACCGGATCCTCCGAGGTTCTCTGTACTTTTCTTCCTCTGCTCGCGTTCCCCCTTCCTCCA
AGTACACAGAACTTGGAGTCTAGGTGGGGCCCCCATCCCGTCACCCCGCGCAACCACGCGGCTCCGGCCTCCATC
ATCGAAAGCCTCAATCGCGGCCTTTTCCCTCCTTACCTAAATCCACGCATCTTGATCGCTACCAAAAAATAGAAA
GAAAAAAAAAACCCCTCTCGATCTCAACAACGCTCAACCGTTTTGGCACTTCAAGCCATGACCCGCTGCCCATCT
TTCGACTCCCTCGGCCGGAGCGCAGCCTAGAGACATTTCCACCCCGTTCCCGCATTCCAGTCGGCGGGCCGGTCC
GGACGATGGCGCCCGCGCCTCAGGATCGGCTTTCGCCGCCCGGTGGTGCGGGTTATAGCTCTGACTTGCTGGTTG
TGGGCGATGGGACTTGGGATTTGTCGCGGAATACCTTTCTGCTTCCCAATCTTCAGGGGGTCAACTTTGATACGA
TGCGGTATAATGGTTAGACTTGTCTTTTTTTCTGTCGTTGAGGGACCGTGTGTGTTGCTGACCATTGTTTTAGGG
ATGGGCAATCGGTTCGGTTCGCTCGCTCAGTATCATCGTATCGTTCTCGCCCACGCAATCCTCGCCGCTCTCGTC
TTTCTCCTCATCGTGCCGACAGCCATCATGACGGCGCGTTTCTACGCCCAGAGACCGGGATACGCCGTCGTCTTT
CACGCTCAGATGCAGATACTGGCCGGTCTCATGCTGCTCGCCGTCTTTATTCTCGGCTACTTTGCCGTCGGACCG
AGCCGGAGCCTGACGAATCCGCACCACGGCATCGGCGTCGCCATCTTCGTCCTCTTTATCCTTCAGCTGGTGGGC
GGCCGTCTGGTGCGCCATATTGTCAAGATGCGGTCGCTACGCATCATGATTCATCAGTGGTGTGGCCGCGCCATT
GCTCTTCTCGGCATCGTCCAGGTTCCTCTCGGTCTCACCCTCTACGGCTCGCCGAAATACGTCTTTGTCCTATAC
ACCCTATGGATGATCTTCCTGCTCCTCGTCTACTTCGCTTTGAGTTACAGGTCGGCCGGTCGTCGCGAGCTGTAT
ATGAGCGGAGGAACAGCCGCCCGGTCAGAAGCCGGACACAGCAGAGTCACTGAGTCCGAATACTTGTCCAACAAC
CCCAGATCCGAGCCGGGAAGCGGTCCATTCAAGTGGCTCGGCCCGCTCGCTGCTCTCGGCGGCCTGGCACTAGCA
TCCGGTCGCAATAAGGAACGAGCGCGGAGCCGCAGTCGGAGCCGCGCTAGGTCACGCTCGTATAGCAGAGGGCCG
GCCGGTGACGTCGGTCATTCGAGACGCGGCTCAGAGAGTTATCTCAGCGACAAGGAGACGGAGTTGACGTCGCCG
AGGACCGGACGTGGAGCTGGTGGAGGCGGGGGGTTCTCCAAGCTGGTCGGCGGCGCGGCTGCGGCTTTCGGCGTC
TCTAAGCTCGTCTCCGGTCTGACGGGCCGACGACGGGGTGGCGAACGGGATGACGACTACTCTGCTGTGGCAACG
GACACTCCTCGGAGACAGCGGTCTGGACGCGGTCCCCTTGCTCCGACGGCCAGCGAGTTTAGCAGCGACTATACC
GACAACTACGGCCGTCGCCTACATGACGGCACCAACACGTCTTTTCTACCGCCGTCGGCGAATCCTCCGCCGCCT
GTGGCCGGAGAAGGACGTCGTCCAACGACGCCTCGGCCCATGTACGCTCGCAGCGCCGCAGATCATGACGAGAGC
GACTACACGTCCTACGTCAGCCCGTCTCGACGCGCGTCAGGGGATCGATCGGGAGGCGGCTTTGCCAAGGGTCTG
CTATCTGGCCTCGGAGCTGGCTGGATCGCAAAGAAGATGGCCGACAGGCGGGATAGGAGGGAAGATGCGAGGCTA
CGAGACGAGGAGGAAATGAGAGCCGGGACGCATGGCTCTCGGTACACGGGCGATGGACATCCGTCGCCGACCAGA
CGAAGCCGGCTACCGACCAGGCGGAGAACACAGACCGTATCCGAGGTGACGGAGTCGTCCGTCAACATCCCGCCG
TCTGCGCCTCAGCACGGGCGCTCACGATCCAACGTCGAGCACGTCTCCATGCCGCCGATGCCGCCAGATCCAGAT
ACCCCCGAGCGACGGACATCATCGCGGAGACGGCGAGAAGGAGAGCGAGCGCAGGCAGAAGCAGTGGCGCGGGCT
AGCGACCTCGCCATTCACCAGGGCCATGCGCACAGCGACGCGAGGGGGGCGCATCTGCCATCGCCGCAGGGCGGG
CCGCTGAGCGTCAAGCTCAAGATGCACGACGACCGGGACCGCAACGTGACGCTCCGGCGACTCACGGAGGAGGAG
GCGGCGCGGGCGAATCGCGGTCATGGAGGCGGCCACGGAGAGTCGGAGAGCAGCATCTCCGGGCTCGAGTCGGCG
GGCTACGGCCGGCGATATCGGCGCGAGCCCAGCCAGCAGGGACGCATGGAGCGGGCGGCCGAAAGAGTGGCCGAG
CGAAAGGTTAGAGTCGTCGACGAGGAGAACCATCACCTGCCTCCGCTCTCTCCACCACAGCCATCGTTTGCGAAG
ACGGCGAGGCGCAACGGCGGCAAGGACTCGGCTTACTACTCGGGGGCCGGAGGAGGGCCATCGGGGGCGCCTCCG
GTCGTCCCGTCACAGACTGCCTCTAGCGGAGGGAGCCCAGACAGCCACGCGACATGGAGTCAGATGACTCCTTCG
CCGGCTGCGAAGATGGACTCGGCTGAGGATAGGCGGAGGAGGCGGAGACAGGAGCGGAGGGCGGCGGCGAGCACG
ACGAGCAGGCCTTCGGGGCAGGACATGTTTGAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail