Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03422
Gene name
Locationscaffold_03:2630596..2633503
Strand+
Gene length (bp)2907
Transcript length (bp)2907
Coding sequence length (bp)2907
Protein length (aa) 969

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 188 210 22
2 231 253 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 60.29 33.44 87.13
Alive In ants, during behavior modification 59.01 32.29 85.74
Dead In ants, recently dead 58.41 32.41 84.40

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.931962 no
Alive Dead 0.964931 no
Dead Fungus 0.897414 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03422
MPRASSSGKRQLGAGVGLREARHDHGLVGSGRRISAATRGCGYLNVCSDSYASVSQPSPPSPPLPSPPPPPPQSP
PLPPPSLAANGLVNGGHVKRRADDAHVPPGLDLRPGHALRRRSLDDAYSETSSESCLSILGPGPDGGHRHIDVNA
MKNADVHRDSGPLDLAVSVVRSLPIQDTLAILIILMHVPYLSLTLVYACFASLTFVPPVASRAGWNINFGDIFDG
NSHAPSLATVVCMDFFFFLIWVFLWPPIQDSILEFAKPVIAVTLGGGTSAKDGTSQGVTACFAWVLLHKLVRASR
RYWPRLAHHLPDAWRVRAVLGGSLPTATATTAVTKTTTAAALHAPYDKRDTHGWIQSVLAIHILTQGIVRYIREW
YLRRERFHAVAGPGDPEAAKSASAVAGASVPSLAGSADATHDAALNTPDAETSPLASSPHPAGLTKKRRKQSAQV
RLQQPLWAALASTKIVAMKEIELSTWAGGRSDKRDIHNAGTAPSFDRQPRQIWISYIGSDEVCFSTSHFPDEADD
EPCKAHGARPAGVDTNKPFYVRINNAFWQPTRIFPVGGDGAGAHGWTGDIYGLRPASKYVCEFVHLQTDQVLFTT
SIRTVKEPLRDRDVSSPGQPGGQQPLRPDSPATTLRTSIEASEARLLEEKNKLKSYRKDAKARINALKKENELTE
NQLASAGGNDDRFRQKIRQQETQKAQTERDLCDLSEQIKLLDEAGPELSERKKQAERAFSAEKRVYDAAQKQLKE
HRSQLAKDVKAKEAEKSNLIARRNKTATRIAKVENELASISNSNNRGKGEVERRRQERNRWLEQAAAAEQGYSER
LAQLVAVNQRKREHVRELQAQLDSIFVKPANGIKMEGAAPSFRRTSPWNSSPMATNYPWTPDVRTASMTARMPPP
TGFDSRGARARVRSSSMLSDVSGFTQASDDGSASAPVGTRPRARPSAAAGLRDGSSGSGSGSSVGEAS*
Coding >Ophcf2|03422
ATGCCTCGGGCGTCGAGCTCGGGCAAGCGACAGCTGGGCGCCGGCGTCGGCCTCCGCGAGGCGAGGCACGATCAT
GGGCTTGTAGGCTCTGGAAGGCGCATATCGGCCGCTACAAGGGGCTGCGGCTACCTCAACGTCTGCTCCGACAGC
TATGCCTCTGTTTCTCAGCCGTCGCCTCCCTCGCCGCCCTTGCCCTCGCCGCCTCCGCCGCCTCCGCAGTCGCCG
CCGCTGCCGCCACCTTCGCTTGCCGCCAACGGTCTTGTCAACGGCGGCCATGTCAAGAGACGCGCTGACGATGCT
CACGTCCCGCCAGGCCTTGATCTTCGTCCAGGTCATGCTCTCCGCAGGCGCTCGCTCGACGACGCCTACTCAGAG
ACCTCGTCCGAGTCGTGTCTCTCCATCCTGGGCCCTGGGCCGGACGGCGGTCATCGCCACATCGACGTCAATGCA
ATGAAGAACGCCGACGTTCACCGTGACTCGGGGCCCCTTGATCTCGCTGTCAGCGTCGTTCGCTCTTTGCCCATC
CAGGACACGCTCGCCATACTCATCATTCTTATGCACGTCCCCTACCTCTCGCTGACTCTGGTCTATGCCTGCTTC
GCCTCCCTCACATTCGTTCCTCCCGTCGCCAGCAGGGCCGGCTGGAACATCAACTTTGGCGATATATTCGACGGC
AACTCGCATGCGCCTTCGCTCGCCACCGTCGTCTGCATGGATTTCTTCTTCTTCCTCATCTGGGTCTTTCTCTGG
CCGCCCATACAGGACTCGATCCTTGAGTTCGCCAAGCCCGTCATTGCCGTCACACTCGGAGGCGGCACCAGCGCC
AAGGACGGCACCTCGCAAGGCGTCACCGCTTGCTTCGCCTGGGTCCTGCTTCACAAGCTCGTCCGCGCCTCGAGG
CGCTACTGGCCTCGTCTAGCCCATCACTTACCCGATGCGTGGCGCGTCCGGGCCGTCCTAGGCGGTTCCTTGCCG
ACGGCGACGGCTACGACGGCGGTGACTAAGACGACAACTGCCGCCGCTCTTCACGCGCCGTACGATAAGAGAGAC
ACGCACGGGTGGATTCAGAGCGTCCTCGCCATCCACATACTTACCCAAGGGATCGTCAGGTATATTCGCGAATGG
TACCTTCGCCGCGAACGCTTCCATGCCGTGGCCGGTCCGGGTGATCCGGAGGCGGCCAAGTCTGCCTCGGCCGTT
GCCGGCGCGAGCGTCCCCAGCCTCGCGGGTTCTGCCGACGCGACTCACGACGCGGCCCTAAACACGCCCGACGCC
GAGACGAGCCCCCTCGCTTCCTCACCTCATCCGGCCGGCTTGACGAAGAAGCGGCGAAAGCAGAGCGCCCAGGTG
CGTCTTCAGCAACCGCTATGGGCGGCGCTCGCCAGCACCAAGATCGTGGCCATGAAGGAGATTGAGCTCTCCACC
TGGGCGGGCGGCAGGTCCGACAAGCGAGACATCCACAATGCCGGGACTGCACCGTCTTTCGATCGACAGCCGAGG
CAGATCTGGATCTCCTACATCGGTAGCGACGAAGTCTGCTTCAGCACCAGTCACTTCCCGGACGAGGCCGACGAC
GAGCCTTGCAAGGCCCACGGCGCCAGACCCGCCGGCGTGGACACGAACAAGCCCTTTTACGTCAGGATTAACAAC
GCCTTCTGGCAGCCCACGCGCATCTTCCCCGTCGGCGGAGACGGTGCTGGCGCGCACGGATGGACGGGCGACATC
TACGGCCTGCGTCCCGCGTCCAAGTACGTGTGCGAATTTGTGCACCTTCAGACGGACCAGGTCCTGTTCACGACG
AGCATTCGCACGGTTAAGGAACCCCTGCGCGATCGAGACGTGTCTTCGCCCGGCCAGCCGGGCGGCCAGCAGCCT
CTGCGCCCAGACTCACCCGCAACCACTCTCCGGACCTCGATCGAGGCGTCCGAGGCTAGGCTCCTCGAGGAAAAG
AACAAGCTCAAGTCGTATCGCAAGGACGCAAAGGCCCGCATCAACGCGCTGAAGAAGGAGAACGAGCTGACCGAG
AACCAGCTCGCTTCGGCGGGTGGCAACGACGACCGGTTCAGGCAAAAGATCCGGCAGCAGGAGACGCAAAAGGCC
CAGACGGAGCGCGACTTGTGCGACCTGTCGGAGCAGATCAAGCTGTTGGACGAGGCCGGGCCCGAGCTTTCGGAG
CGTAAGAAGCAGGCGGAGAGGGCCTTTTCGGCCGAAAAGAGGGTGTACGATGCGGCACAGAAGCAGCTTAAGGAG
CACAGGTCTCAGCTGGCCAAGGATGTTAAAGCCAAGGAGGCGGAGAAGTCGAACCTGATTGCTCGGCGCAATAAG
ACCGCAACTCGCATCGCCAAGGTCGAAAACGAGCTCGCAAGCATCAGCAACTCCAACAACCGCGGCAAGGGCGAG
GTGGAGCGCCGGCGTCAGGAGAGGAACAGGTGGCTGGAACAGGCGGCGGCGGCAGAGCAAGGCTACTCGGAGCGA
CTGGCGCAGCTGGTGGCCGTCAACCAGAGAAAGAGGGAGCACGTGCGCGAGCTGCAGGCGCAGCTGGACTCGATC
TTCGTGAAGCCGGCCAACGGGATCAAGATGGAGGGCGCTGCTCCGTCCTTTCGGCGGACGAGCCCGTGGAACTCT
AGTCCGATGGCTACCAACTACCCCTGGACCCCAGACGTGCGGACGGCCAGCATGACGGCGCGGATGCCTCCTCCG
ACGGGCTTCGACAGTCGCGGCGCAAGGGCTCGGGTTAGGAGCTCGAGCATGCTTAGTGACGTGAGCGGCTTCACC
CAGGCCAGCGACGACGGCTCGGCGTCGGCTCCGGTCGGGACACGGCCACGGGCTCGACCGTCGGCAGCGGCCGGT
TTGAGGGACGGGAGTAGCGGCAGCGGCAGCGGCAGCAGCGTGGGCGAGGCCAGCTGA
Transcript >Ophcf2|03422
ATGCCTCGGGCGTCGAGCTCGGGCAAGCGACAGCTGGGCGCCGGCGTCGGCCTCCGCGAGGCGAGGCACGATCAT
GGGCTTGTAGGCTCTGGAAGGCGCATATCGGCCGCTACAAGGGGCTGCGGCTACCTCAACGTCTGCTCCGACAGC
TATGCCTCTGTTTCTCAGCCGTCGCCTCCCTCGCCGCCCTTGCCCTCGCCGCCTCCGCCGCCTCCGCAGTCGCCG
CCGCTGCCGCCACCTTCGCTTGCCGCCAACGGTCTTGTCAACGGCGGCCATGTCAAGAGACGCGCTGACGATGCT
CACGTCCCGCCAGGCCTTGATCTTCGTCCAGGTCATGCTCTCCGCAGGCGCTCGCTCGACGACGCCTACTCAGAG
ACCTCGTCCGAGTCGTGTCTCTCCATCCTGGGCCCTGGGCCGGACGGCGGTCATCGCCACATCGACGTCAATGCA
ATGAAGAACGCCGACGTTCACCGTGACTCGGGGCCCCTTGATCTCGCTGTCAGCGTCGTTCGCTCTTTGCCCATC
CAGGACACGCTCGCCATACTCATCATTCTTATGCACGTCCCCTACCTCTCGCTGACTCTGGTCTATGCCTGCTTC
GCCTCCCTCACATTCGTTCCTCCCGTCGCCAGCAGGGCCGGCTGGAACATCAACTTTGGCGATATATTCGACGGC
AACTCGCATGCGCCTTCGCTCGCCACCGTCGTCTGCATGGATTTCTTCTTCTTCCTCATCTGGGTCTTTCTCTGG
CCGCCCATACAGGACTCGATCCTTGAGTTCGCCAAGCCCGTCATTGCCGTCACACTCGGAGGCGGCACCAGCGCC
AAGGACGGCACCTCGCAAGGCGTCACCGCTTGCTTCGCCTGGGTCCTGCTTCACAAGCTCGTCCGCGCCTCGAGG
CGCTACTGGCCTCGTCTAGCCCATCACTTACCCGATGCGTGGCGCGTCCGGGCCGTCCTAGGCGGTTCCTTGCCG
ACGGCGACGGCTACGACGGCGGTGACTAAGACGACAACTGCCGCCGCTCTTCACGCGCCGTACGATAAGAGAGAC
ACGCACGGGTGGATTCAGAGCGTCCTCGCCATCCACATACTTACCCAAGGGATCGTCAGGTATATTCGCGAATGG
TACCTTCGCCGCGAACGCTTCCATGCCGTGGCCGGTCCGGGTGATCCGGAGGCGGCCAAGTCTGCCTCGGCCGTT
GCCGGCGCGAGCGTCCCCAGCCTCGCGGGTTCTGCCGACGCGACTCACGACGCGGCCCTAAACACGCCCGACGCC
GAGACGAGCCCCCTCGCTTCCTCACCTCATCCGGCCGGCTTGACGAAGAAGCGGCGAAAGCAGAGCGCCCAGGTG
CGTCTTCAGCAACCGCTATGGGCGGCGCTCGCCAGCACCAAGATCGTGGCCATGAAGGAGATTGAGCTCTCCACC
TGGGCGGGCGGCAGGTCCGACAAGCGAGACATCCACAATGCCGGGACTGCACCGTCTTTCGATCGACAGCCGAGG
CAGATCTGGATCTCCTACATCGGTAGCGACGAAGTCTGCTTCAGCACCAGTCACTTCCCGGACGAGGCCGACGAC
GAGCCTTGCAAGGCCCACGGCGCCAGACCCGCCGGCGTGGACACGAACAAGCCCTTTTACGTCAGGATTAACAAC
GCCTTCTGGCAGCCCACGCGCATCTTCCCCGTCGGCGGAGACGGTGCTGGCGCGCACGGATGGACGGGCGACATC
TACGGCCTGCGTCCCGCGTCCAAGTACGTGTGCGAATTTGTGCACCTTCAGACGGACCAGGTCCTGTTCACGACG
AGCATTCGCACGGTTAAGGAACCCCTGCGCGATCGAGACGTGTCTTCGCCCGGCCAGCCGGGCGGCCAGCAGCCT
CTGCGCCCAGACTCACCCGCAACCACTCTCCGGACCTCGATCGAGGCGTCCGAGGCTAGGCTCCTCGAGGAAAAG
AACAAGCTCAAGTCGTATCGCAAGGACGCAAAGGCCCGCATCAACGCGCTGAAGAAGGAGAACGAGCTGACCGAG
AACCAGCTCGCTTCGGCGGGTGGCAACGACGACCGGTTCAGGCAAAAGATCCGGCAGCAGGAGACGCAAAAGGCC
CAGACGGAGCGCGACTTGTGCGACCTGTCGGAGCAGATCAAGCTGTTGGACGAGGCCGGGCCCGAGCTTTCGGAG
CGTAAGAAGCAGGCGGAGAGGGCCTTTTCGGCCGAAAAGAGGGTGTACGATGCGGCACAGAAGCAGCTTAAGGAG
CACAGGTCTCAGCTGGCCAAGGATGTTAAAGCCAAGGAGGCGGAGAAGTCGAACCTGATTGCTCGGCGCAATAAG
ACCGCAACTCGCATCGCCAAGGTCGAAAACGAGCTCGCAAGCATCAGCAACTCCAACAACCGCGGCAAGGGCGAG
GTGGAGCGCCGGCGTCAGGAGAGGAACAGGTGGCTGGAACAGGCGGCGGCGGCAGAGCAAGGCTACTCGGAGCGA
CTGGCGCAGCTGGTGGCCGTCAACCAGAGAAAGAGGGAGCACGTGCGCGAGCTGCAGGCGCAGCTGGACTCGATC
TTCGTGAAGCCGGCCAACGGGATCAAGATGGAGGGCGCTGCTCCGTCCTTTCGGCGGACGAGCCCGTGGAACTCT
AGTCCGATGGCTACCAACTACCCCTGGACCCCAGACGTGCGGACGGCCAGCATGACGGCGCGGATGCCTCCTCCG
ACGGGCTTCGACAGTCGCGGCGCAAGGGCTCGGGTTAGGAGCTCGAGCATGCTTAGTGACGTGAGCGGCTTCACC
CAGGCCAGCGACGACGGCTCGGCGTCGGCTCCGGTCGGGACACGGCCACGGGCTCGACCGTCGGCAGCGGCCGGT
TTGAGGGACGGGAGTAGCGGCAGCGGCAGCGGCAGCAGCGTGGGCGAGGCCAGCTGA
Gene >Ophcf2|03422
ATGCCTCGGGCGTCGAGCTCGGGCAAGCGACAGCTGGGCGCCGGCGTCGGCCTCCGCGAGGCGAGGCACGATCAT
GGGCTTGTAGGCTCTGGAAGGCGCATATCGGCCGCTACAAGGGGCTGCGGCTACCTCAACGTCTGCTCCGACAGC
TATGCCTCTGTTTCTCAGCCGTCGCCTCCCTCGCCGCCCTTGCCCTCGCCGCCTCCGCCGCCTCCGCAGTCGCCG
CCGCTGCCGCCACCTTCGCTTGCCGCCAACGGTCTTGTCAACGGCGGCCATGTCAAGAGACGCGCTGACGATGCT
CACGTCCCGCCAGGCCTTGATCTTCGTCCAGGTCATGCTCTCCGCAGGCGCTCGCTCGACGACGCCTACTCAGAG
ACCTCGTCCGAGTCGTGTCTCTCCATCCTGGGCCCTGGGCCGGACGGCGGTCATCGCCACATCGACGTCAATGCA
ATGAAGAACGCCGACGTTCACCGTGACTCGGGGCCCCTTGATCTCGCTGTCAGCGTCGTTCGCTCTTTGCCCATC
CAGGACACGCTCGCCATACTCATCATTCTTATGCACGTCCCCTACCTCTCGCTGACTCTGGTCTATGCCTGCTTC
GCCTCCCTCACATTCGTTCCTCCCGTCGCCAGCAGGGCCGGCTGGAACATCAACTTTGGCGATATATTCGACGGC
AACTCGCATGCGCCTTCGCTCGCCACCGTCGTCTGCATGGATTTCTTCTTCTTCCTCATCTGGGTCTTTCTCTGG
CCGCCCATACAGGACTCGATCCTTGAGTTCGCCAAGCCCGTCATTGCCGTCACACTCGGAGGCGGCACCAGCGCC
AAGGACGGCACCTCGCAAGGCGTCACCGCTTGCTTCGCCTGGGTCCTGCTTCACAAGCTCGTCCGCGCCTCGAGG
CGCTACTGGCCTCGTCTAGCCCATCACTTACCCGATGCGTGGCGCGTCCGGGCCGTCCTAGGCGGTTCCTTGCCG
ACGGCGACGGCTACGACGGCGGTGACTAAGACGACAACTGCCGCCGCTCTTCACGCGCCGTACGATAAGAGAGAC
ACGCACGGGTGGATTCAGAGCGTCCTCGCCATCCACATACTTACCCAAGGGATCGTCAGGTATATTCGCGAATGG
TACCTTCGCCGCGAACGCTTCCATGCCGTGGCCGGTCCGGGTGATCCGGAGGCGGCCAAGTCTGCCTCGGCCGTT
GCCGGCGCGAGCGTCCCCAGCCTCGCGGGTTCTGCCGACGCGACTCACGACGCGGCCCTAAACACGCCCGACGCC
GAGACGAGCCCCCTCGCTTCCTCACCTCATCCGGCCGGCTTGACGAAGAAGCGGCGAAAGCAGAGCGCCCAGGTG
CGTCTTCAGCAACCGCTATGGGCGGCGCTCGCCAGCACCAAGATCGTGGCCATGAAGGAGATTGAGCTCTCCACC
TGGGCGGGCGGCAGGTCCGACAAGCGAGACATCCACAATGCCGGGACTGCACCGTCTTTCGATCGACAGCCGAGG
CAGATCTGGATCTCCTACATCGGTAGCGACGAAGTCTGCTTCAGCACCAGTCACTTCCCGGACGAGGCCGACGAC
GAGCCTTGCAAGGCCCACGGCGCCAGACCCGCCGGCGTGGACACGAACAAGCCCTTTTACGTCAGGATTAACAAC
GCCTTCTGGCAGCCCACGCGCATCTTCCCCGTCGGCGGAGACGGTGCTGGCGCGCACGGATGGACGGGCGACATC
TACGGCCTGCGTCCCGCGTCCAAGTACGTGTGCGAATTTGTGCACCTTCAGACGGACCAGGTCCTGTTCACGACG
AGCATTCGCACGGTTAAGGAACCCCTGCGCGATCGAGACGTGTCTTCGCCCGGCCAGCCGGGCGGCCAGCAGCCT
CTGCGCCCAGACTCACCCGCAACCACTCTCCGGACCTCGATCGAGGCGTCCGAGGCTAGGCTCCTCGAGGAAAAG
AACAAGCTCAAGTCGTATCGCAAGGACGCAAAGGCCCGCATCAACGCGCTGAAGAAGGAGAACGAGCTGACCGAG
AACCAGCTCGCTTCGGCGGGTGGCAACGACGACCGGTTCAGGCAAAAGATCCGGCAGCAGGAGACGCAAAAGGCC
CAGACGGAGCGCGACTTGTGCGACCTGTCGGAGCAGATCAAGCTGTTGGACGAGGCCGGGCCCGAGCTTTCGGAG
CGTAAGAAGCAGGCGGAGAGGGCCTTTTCGGCCGAAAAGAGGGTGTACGATGCGGCACAGAAGCAGCTTAAGGAG
CACAGGTCTCAGCTGGCCAAGGATGTTAAAGCCAAGGAGGCGGAGAAGTCGAACCTGATTGCTCGGCGCAATAAG
ACCGCAACTCGCATCGCCAAGGTCGAAAACGAGCTCGCAAGCATCAGCAACTCCAACAACCGCGGCAAGGGCGAG
GTGGAGCGCCGGCGTCAGGAGAGGAACAGGTGGCTGGAACAGGCGGCGGCGGCAGAGCAAGGCTACTCGGAGCGA
CTGGCGCAGCTGGTGGCCGTCAACCAGAGAAAGAGGGAGCACGTGCGCGAGCTGCAGGCGCAGCTGGACTCGATC
TTCGTGAAGCCGGCCAACGGGATCAAGATGGAGGGCGCTGCTCCGTCCTTTCGGCGGACGAGCCCGTGGAACTCT
AGTCCGATGGCTACCAACTACCCCTGGACCCCAGACGTGCGGACGGCCAGCATGACGGCGCGGATGCCTCCTCCG
ACGGGCTTCGACAGTCGCGGCGCAAGGGCTCGGGTTAGGAGCTCGAGCATGCTTAGTGACGTGAGCGGCTTCACC
CAGGCCAGCGACGACGGCTCGGCGTCGGCTCCGGTCGGGACACGGCCACGGGCTCGACCGTCGGCAGCGGCCGGT
TTGAGGGACGGGAGTAGCGGCAGCGGCAGCGGCAGCAGCGTGGGCGAGGCCAGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail