Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03421
Gene name
Locationscaffold_03:2627355..2627692
Strand-
Gene length (bp)337
Transcript length (bp)213
Coding sequence length (bp)213
Protein length (aa) 71

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13233 Complex1_LYR_2 Complex1_LYR-like 1.5E-05 12 68
PF05347 Complex1_LYR Complex 1 protein (LYR family) 3.8E-05 10 61

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Mitochondrial transit peptide 0.4544 0.2142 0.051 0.0322 0.8855 0.0441 0.0209 0.062 0.0504 0.0121

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5130
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis map64 (Brazil) OphauB2|6213
Ophiocordyceps camponoti-floridani Ophcf2|03421 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|2414
Ophiocordyceps kimflemingae Ophio5|6865
Ophiocordyceps subramaniannii Hirsu2|3475

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03421
MTSHNPELRRQVIAIYKELLHLGREYPLGFAYFRPRLHEAFMSRAHLQNEAEIVSSIEKAEYVKKEIEAL*
Coding >Ophcf2|03421
ATGACCAGCCATAACCCCGAGTTGCGGCGGCAGGTCATAGCTATCTACAAAGAGCTCCTCCACCTGGGTCGAGAA
TACCCGCTCGGGTTCGCCTACTTTCGTCCGCGCCTACACGAGGCCTTTATGTCCCGTGCCCACCTGCAAAACGAG
GCCGAGATAGTCTCGTCCATTGAAAAGGCAGAATACGTCAAGAAAGAAATCGAAGCCCTGTAA
Transcript >Ophcf2|03421
ATGACCAGCCATAACCCCGAGTTGCGGCGGCAGGTCATAGCTATCTACAAAGAGCTCCTCCACCTGGGTCGAGAA
TACCCGCTCGGGTTCGCCTACTTTCGTCCGCGCCTACACGAGGCCTTTATGTCCCGTGCCCACCTGCAAAACGAG
GCCGAGATAGTCTCGTCCATTGAAAAGGCAGAATACGTCAAGAAAGAAATCGAAGCCCTGTAA
Gene >Ophcf2|03421
ATGACCAGCCATAACCCCGAGTTGCGGCGGCAGGTCATAGCTATCTACAAAGGTAGAGCCCAGCTGTTTCAGTTC
TGGACTGCATACCTAAGCTAATGGCCACAGAGCTCCTCCACCTGGGTCGAGAATACCCGCTCGGGTTCGCCTACT
TTCGTCCGCGCCTACACGAGGCCTTTATGTCCCGTGCCCACCTGCAAAACGAGGCCGAGATAGTCTCGTCCATTG
AAAAGGCAGAATACGTCAAGAAAGGCACGGCCTGCGTCCGCCAGCCAGTCCCAGCCCCCGCCCCCGCCCGTTGCT
GACCTCGCCTCCCGTGACAGAAATCGAAGCCCTGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail