Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03414
Gene name
Locationscaffold_03:2611572..2612976
Strand+
Gene length (bp)1404
Transcript length (bp)1275
Coding sequence length (bp)1275
Protein length (aa) 425

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01529 DHHC DHHC palmitoyltransferase 2.4E-25 160 279

GO

GO Term Description Terminal node
GO:0016409 palmitoyltransferase activity Yes
GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups No
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0016746 acyltransferase activity No
GO:0016740 transferase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.5

Transmembrane Domains

Domain # Start End Length
1 15 37 22
2 49 71 22
3 207 229 22
4 241 263 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 29.04 14.83 43.26
Alive In ants, during behavior modification 20.17 9.45 30.88
Dead In ants, recently dead 24.69 12.14 37.23

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.099299 no
Alive Dead 0.333244 no
Dead Fungus 0.489010 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03414
MRPSDSNRTATRWSIRLMPLFIAAVLGIATYSVVYRLCVRFLYRKLGKSGLTATFLVLYWVFFLLAGASYFRTFA
AAQFNSGLVPLLYERDAFIRPSSDEQSSAMCAGKGFVGAFAKRPSKGRGRDPERSPWVPPDQDPDSPGLEAFYSK
DVFLCEPDGRPKWCSDCRQWKPDRAHHSSELDRCVRKMDHLCPWVGGMVSETSFNFFFQFTFYTFCYCVICLSAC
AYALHQEKLRGPKVDGWFIAVVAIASIFTFFTLAMTLTSARLILTNYTSIDILRKSQVIFLAVRIPRNSPSTEAF
TTVSYPLERPPPSMSDTSHARSSMDRDPSRDRRATRKFAILRLEPNDNPWDLGYWGNWKSVMGSNVFEWLLPIRH
SPCCNHESMESDYRLGPLLAASKKRYGVPELDGDVDGVVEMHDTAMLAP*
Coding >Ophcf2|03414
ATGCGGCCAAGCGACAGCAATCGCACCGCCACCCGCTGGTCCATCCGGCTGATGCCCCTGTTCATCGCCGCTGTT
CTGGGAATCGCGACCTACTCCGTCGTCTACCGCCTGTGTGTCCGCTTCTTGTACCGGAAGCTGGGCAAGTCGGGC
CTCACCGCTACCTTTCTCGTTCTCTACTGGGTCTTCTTCCTGCTGGCTGGCGCGAGCTACTTTCGGACCTTTGCC
GCTGCCCAGTTCAACTCGGGTCTCGTCCCGCTGTTGTACGAGCGCGATGCTTTCATCCGGCCGTCGTCGGACGAG
CAGTCGTCTGCCATGTGTGCCGGTAAGGGATTCGTTGGAGCGTTTGCCAAACGGCCGAGCAAGGGTCGAGGTCGG
GATCCGGAGAGGAGTCCGTGGGTGCCGCCGGATCAGGACCCGGACAGCCCCGGCCTCGAGGCCTTCTACAGCAAG
GACGTCTTTCTCTGCGAACCCGACGGAAGACCAAAGTGGTGCTCCGACTGTCGACAGTGGAAGCCCGACCGTGCT
CATCACTCGAGCGAGCTGGACCGCTGCGTCCGCAAGATGGACCATCTGTGTCCCTGGGTCGGCGGCATGGTGTCC
GAGACGTCTTTCAACTTTTTCTTTCAGTTCACATTTTACACGTTTTGTTACTGCGTCATCTGCCTCTCCGCTTGC
GCTTACGCCCTGCATCAGGAGAAGCTTCGCGGTCCCAAGGTCGACGGCTGGTTCATCGCCGTAGTCGCAATCGCC
TCCATCTTCACCTTCTTCACATTGGCAATGACGCTGACGTCTGCGCGCCTCATACTCACAAACTACACCAGCATC
GACATCCTGAGAAAGTCGCAAGTCATCTTTCTCGCCGTCCGCATCCCGCGAAACAGCCCGTCTACCGAGGCCTTC
ACCACCGTCAGCTACCCGCTGGAACGTCCTCCGCCCAGCATGTCGGACACGTCGCACGCCCGCTCCAGCATGGAC
CGCGATCCGTCTAGGGACCGGCGCGCGACGAGGAAGTTCGCCATCTTGCGGCTCGAGCCAAACGACAACCCCTGG
GATCTGGGCTACTGGGGGAACTGGAAGTCCGTCATGGGCAGCAACGTCTTTGAGTGGCTGCTGCCCATCCGACAC
TCCCCTTGCTGCAACCACGAGAGCATGGAGAGCGACTACCGGCTGGGGCCGCTGCTGGCCGCTTCCAAGAAGAGG
TATGGCGTGCCCGAGCTCGACGGAGATGTCGACGGGGTGGTTGAGATGCACGATACGGCCATGCTTGCGCCGTGA
Transcript >Ophcf2|03414
ATGCGGCCAAGCGACAGCAATCGCACCGCCACCCGCTGGTCCATCCGGCTGATGCCCCTGTTCATCGCCGCTGTT
CTGGGAATCGCGACCTACTCCGTCGTCTACCGCCTGTGTGTCCGCTTCTTGTACCGGAAGCTGGGCAAGTCGGGC
CTCACCGCTACCTTTCTCGTTCTCTACTGGGTCTTCTTCCTGCTGGCTGGCGCGAGCTACTTTCGGACCTTTGCC
GCTGCCCAGTTCAACTCGGGTCTCGTCCCGCTGTTGTACGAGCGCGATGCTTTCATCCGGCCGTCGTCGGACGAG
CAGTCGTCTGCCATGTGTGCCGGTAAGGGATTCGTTGGAGCGTTTGCCAAACGGCCGAGCAAGGGTCGAGGTCGG
GATCCGGAGAGGAGTCCGTGGGTGCCGCCGGATCAGGACCCGGACAGCCCCGGCCTCGAGGCCTTCTACAGCAAG
GACGTCTTTCTCTGCGAACCCGACGGAAGACCAAAGTGGTGCTCCGACTGTCGACAGTGGAAGCCCGACCGTGCT
CATCACTCGAGCGAGCTGGACCGCTGCGTCCGCAAGATGGACCATCTGTGTCCCTGGGTCGGCGGCATGGTGTCC
GAGACGTCTTTCAACTTTTTCTTTCAGTTCACATTTTACACGTTTTGTTACTGCGTCATCTGCCTCTCCGCTTGC
GCTTACGCCCTGCATCAGGAGAAGCTTCGCGGTCCCAAGGTCGACGGCTGGTTCATCGCCGTAGTCGCAATCGCC
TCCATCTTCACCTTCTTCACATTGGCAATGACGCTGACGTCTGCGCGCCTCATACTCACAAACTACACCAGCATC
GACATCCTGAGAAAGTCGCAAGTCATCTTTCTCGCCGTCCGCATCCCGCGAAACAGCCCGTCTACCGAGGCCTTC
ACCACCGTCAGCTACCCGCTGGAACGTCCTCCGCCCAGCATGTCGGACACGTCGCACGCCCGCTCCAGCATGGAC
CGCGATCCGTCTAGGGACCGGCGCGCGACGAGGAAGTTCGCCATCTTGCGGCTCGAGCCAAACGACAACCCCTGG
GATCTGGGCTACTGGGGGAACTGGAAGTCCGTCATGGGCAGCAACGTCTTTGAGTGGCTGCTGCCCATCCGACAC
TCCCCTTGCTGCAACCACGAGAGCATGGAGAGCGACTACCGGCTGGGGCCGCTGCTGGCCGCTTCCAAGAAGAGG
TATGGCGTGCCCGAGCTCGACGGAGATGTCGACGGGGTGGTTGAGATGCACGATACGGCCATGCTTGCGCCGTGA
Gene >Ophcf2|03414
ATGCGGCCAAGCGACAGCAATCGCACCGCCACCCGCTGGTCCATCCGGCTGATGCCCCTGTTCATCGCCGCTGTT
CTGGGAATCGCGACCTACTCCGTCGTCTACCGCCTGTGTGGTGCGCCTCTACCCTCTCCGGCCCGGTCTCCCCGG
AGTTCTACCCTCTCTTTTAGTCGCTGACGGCTTTCCGATGTCTAGTCCGCTTCTTGTACCGGAAGCTGGGCAAGT
CGGGCCTCACCGCTACCTTTCTCGTTCTCTACTGGGTCTTCTTCCTGCTGGCTGGCGCGAGCTACTTTCGGACCT
TTGCCGCTGCCCAGTTCAACTCGGGTCTCGTCCCGCTGTTGTACGAGCGCGATGCTTTCATCCGGCCGTCGTCGG
ACGAGCAGTCGTCTGCCATGTGTGCCGGTAAGGGATTCGTTGGAGCGTTTGCCAAACGGCCGAGCAAGGGTCGAG
GTCGGGATCCGGAGAGGAGTCCGTGGGTGCCGCCGGATCAGGACCCGGACAGCCCCGGCCTCGAGGCCTTCTACA
GCAAGGACGTCTTTCTCTGCGAACCCGACGGAAGACCAAAGTGGTGCTCCGACTGTCGACAGTGGAAGCCCGACC
GTGCTCATCACTCGAGCGAGCTGGACCGCTGCGTCCGCAAGATGGACCATCTGTGTCCCTGGGTCGGCGGCATGG
TGTCCGAGACGTGTACGTCTCCCGAAAGGAGTCTTCCTCATTGTACTGACCTGCCTCTCAGCTTTCAACTTTTTC
TTTCAGTTCACATTTTACACGTTTTGTTACTGCGTCATCTGCCTCTCCGCTTGCGCTTACGCCCTGCATCAGGAG
AAGCTTCGCGGTCCCAAGGTCGACGGCTGGTTCATCGCCGTAGTCGCAATCGCCTCCATCTTCACCTTCTTCACA
TTGGCAATGACGCTGACGTCTGCGCGCCTCATACTCACAAACTACACCAGCATCGACATCCTGAGAAAGTCGCAA
GTCATCTTTCTCGCCGTCCGCATCCCGCGAAACAGCCCGTCTACCGAGGCCTTCACCACCGTCAGCTACCCGCTG
GAACGTCCTCCGCCCAGCATGTCGGACACGTCGCACGCCCGCTCCAGCATGGACCGCGATCCGTCTAGGGACCGG
CGCGCGACGAGGAAGTTCGCCATCTTGCGGCTCGAGCCAAACGACAACCCCTGGGATCTGGGCTACTGGGGGAAC
TGGAAGTCCGTCATGGGCAGCAACGTCTTTGAGTGGCTGCTGCCCATCCGACACTCCCCTTGCTGCAACCACGAG
AGCATGGAGAGCGACTACCGGCTGGGGCCGCTGCTGGCCGCTTCCAAGAAGAGGTATGGCGTGCCCGAGCTCGAC
GGAGATGTCGACGGGGTGGTTGAGATGCACGATACGGCCATGCTTGCGCCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail