Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03394
Gene name
Locationscaffold_03:2565968..2567184
Strand+
Gene length (bp)1216
Transcript length (bp)1002
Coding sequence length (bp)1002
Protein length (aa) 334

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02629 CoA_binding CoA binding domain 6.4E-28 42 133
PF00549 Ligase_CoA CoA-ligase 3.4E-24 186 310
PF13607 Succ_CoA_lig Succinyl-CoA ligase like flavodoxin domain 4.2E-10 180 292

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Mitochondrial transit peptide 0.1158 0.0509 0.0542 0.101 0.9338 0.0403 0.0462 0.0538 0.0846 0.0248

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup167
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3403
Ophiocordyceps australis 1348a (Ghana) OphauG2|927
Ophiocordyceps australis map64 (Brazil) OphauB2|3849
Ophiocordyceps australis map64 (Brazil) OphauB2|6207
Ophiocordyceps camponoti-floridani Ophcf2|02549
Ophiocordyceps camponoti-floridani Ophcf2|03394 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|1261
Ophiocordyceps camponoti-rufipedis Ophun1|3598
Ophiocordyceps kimflemingae Ophio5|1980
Ophiocordyceps kimflemingae Ophio5|979
Ophiocordyceps subramaniannii Hirsu2|1505
Ophiocordyceps subramaniannii Hirsu2|273

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03394
MLALPRTALRPVAALRLVARRGYSSSTTPYAKTVDNLRINGETKVIYQGFTGKQGTFHAEQAIEYGTKVVGGTNP
KKAGQTHLGLPVFKNVSEAVKETGATATAIFVPPPVAAAGIEEALEAEIPLVVCITEGIPQHDMVRITSMLKSQS
KTRLVGPNCPGIIAPGQCKIGIMPGFIHKRGRIGIVSRSGTLTYEAVNQTTQAGLGQSLVVGIGGDPFSGTNFID
CLKVFTQDKETEGIIMIGEIGGSAEEDASEFLKEANTVNGGKPVVSFIAGISAPPGRRMGHAGAIVSGGKGGADS
KIKALESAGVIVERSPASLGKALYDEFVRRDLL*
Coding >Ophcf2|03394
ATGCTGGCCCTTCCCAGGACGGCGCTGCGCCCTGTCGCCGCGCTCCGACTTGTTGCTCGTCGTGGTTACAGCTCG
TCGACGACGCCTTATGCCAAGACGGTGGATAACTTGCGCATCAATGGCGAGACCAAGGTTATCTATCAGGGCTTT
ACGGGGAAGCAGGGAACCTTTCACGCCGAGCAAGCCATCGAGTATGGAACGAAGGTTGTCGGCGGAACGAATCCC
AAAAAGGCCGGCCAGACCCATCTCGGCCTTCCCGTATTCAAGAACGTCTCTGAAGCCGTCAAGGAGACCGGCGCT
ACGGCCACGGCCATCTTTGTCCCCCCTCCGGTAGCCGCTGCCGGCATCGAGGAGGCCCTTGAGGCCGAGATACCC
TTGGTCGTCTGCATCACCGAGGGCATCCCCCAACACGACATGGTCCGCATCACGTCGATGCTCAAGTCGCAATCC
AAGACGCGCCTAGTCGGCCCCAACTGCCCCGGCATCATTGCTCCGGGCCAGTGCAAGATCGGCATCATGCCCGGC
TTCATCCACAAGCGCGGCCGCATCGGCATCGTCTCCCGATCCGGTACCCTCACCTACGAGGCCGTCAACCAGACC
ACTCAAGCCGGCCTAGGCCAGTCACTTGTCGTTGGCATCGGCGGCGATCCCTTTAGCGGAACAAACTTCATCGAC
TGCCTCAAGGTCTTCACGCAGGACAAGGAGACGGAAGGCATCATCATGATCGGCGAGATTGGTGGATCCGCCGAG
GAGGACGCTTCCGAGTTCCTCAAAGAGGCCAACACCGTCAATGGCGGCAAGCCCGTCGTCTCCTTCATTGCCGGA
ATCTCGGCGCCCCCCGGCCGTCGCATGGGCCACGCCGGCGCCATCGTCTCCGGCGGCAAGGGCGGGGCCGACTCC
AAGATCAAGGCTCTCGAGAGCGCCGGCGTCATCGTCGAGCGTTCCCCCGCGAGTCTCGGCAAGGCCCTGTACGAT
GAGTTTGTCCGGCGTGATCTTCTGTAG
Transcript >Ophcf2|03394
ATGCTGGCCCTTCCCAGGACGGCGCTGCGCCCTGTCGCCGCGCTCCGACTTGTTGCTCGTCGTGGTTACAGCTCG
TCGACGACGCCTTATGCCAAGACGGTGGATAACTTGCGCATCAATGGCGAGACCAAGGTTATCTATCAGGGCTTT
ACGGGGAAGCAGGGAACCTTTCACGCCGAGCAAGCCATCGAGTATGGAACGAAGGTTGTCGGCGGAACGAATCCC
AAAAAGGCCGGCCAGACCCATCTCGGCCTTCCCGTATTCAAGAACGTCTCTGAAGCCGTCAAGGAGACCGGCGCT
ACGGCCACGGCCATCTTTGTCCCCCCTCCGGTAGCCGCTGCCGGCATCGAGGAGGCCCTTGAGGCCGAGATACCC
TTGGTCGTCTGCATCACCGAGGGCATCCCCCAACACGACATGGTCCGCATCACGTCGATGCTCAAGTCGCAATCC
AAGACGCGCCTAGTCGGCCCCAACTGCCCCGGCATCATTGCTCCGGGCCAGTGCAAGATCGGCATCATGCCCGGC
TTCATCCACAAGCGCGGCCGCATCGGCATCGTCTCCCGATCCGGTACCCTCACCTACGAGGCCGTCAACCAGACC
ACTCAAGCCGGCCTAGGCCAGTCACTTGTCGTTGGCATCGGCGGCGATCCCTTTAGCGGAACAAACTTCATCGAC
TGCCTCAAGGTCTTCACGCAGGACAAGGAGACGGAAGGCATCATCATGATCGGCGAGATTGGTGGATCCGCCGAG
GAGGACGCTTCCGAGTTCCTCAAAGAGGCCAACACCGTCAATGGCGGCAAGCCCGTCGTCTCCTTCATTGCCGGA
ATCTCGGCGCCCCCCGGCCGTCGCATGGGCCACGCCGGCGCCATCGTCTCCGGCGGCAAGGGCGGGGCCGACTCC
AAGATCAAGGCTCTCGAGAGCGCCGGCGTCATCGTCGAGCGTTCCCCCGCGAGTCTCGGCAAGGCCCTGTACGAT
GAGTTTGTCCGGCGTGATCTTCTGTAG
Gene >Ophcf2|03394
ATGCTGGCCCTTCCCAGGACGGCGCTGCGCCCTGTCGCCGCGCTCCGACTTGTTGCTCGTCGTGGTTACAGCTCG
TCGACGACGCCTTATGCCAAGACGGTGGATAACTTGCGCATCAATGGCGAGACCAAGGTTATCTATCAGGGCTTT
ACGGGGAAGCAGGGAACGTATGTGGTTGTTGTGAACTTGTTGCTCGTGGCCGCGCTGACGACGGACAGCTTTCAC
GCCGAGCAAGCCATCGAGTATGGTGCGTTGGACCGTCAACTGACCACGATTCGCGCTGAATTTTTATTCTCCGAT
GATAGGAACGAAGGTTGTCGGCGGAACGAATCCCAAAAAGGCCGGCCAGACCCATCTCGGCCTTCCCGTATTCAA
GAACGTCTCTGAAGCCGTCAAGGAGACCGGCGCTACGGCCACGGCCATCTTTGTCCCGTACGGCAACCATCCGAG
AAGCATTTCCCGAAATATGACTGACATGATACAAGCCCTCCGGTAGCCGCTGCCGGCATCGAGGAGGCCCTTGAG
GCCGAGATACCCTTGGTCGTCTGCATCACCGAGGGCATCCCCCAACACGGCAAGTTCCTACCTTATACGTAAGCC
CGCTCCGCTGACGCCCTGCTCGTCAGACATGGTCCGCATCACGTCGATGCTCAAGTCGCAATCCAAGACGCGCCT
AGTCGGCCCCAACTGCCCCGGCATCATTGCTCCGGGCCAGTGCAAGATCGGCATCATGCCCGGCTTCATCCACAA
GCGCGGCCGCATCGGCATCGTCTCCCGATCCGGTACCCTCACCTACGAGGCCGTCAACCAGACCACTCAAGCCGG
CCTAGGCCAGTCACTTGTCGTTGGCATCGGCGGCGATCCCTTTAGCGGAACAAACTTCATCGACTGCCTCAAGGT
CTTCACGCAGGACAAGGAGACGGAAGGCATCATCATGATCGGCGAGATTGGTGGATCCGCCGAGGAGGACGCTTC
CGAGTTCCTCAAAGAGGCCAACACCGTCAATGGCGGCAAGCCCGTCGTCTCCTTCATTGCCGGAATCTCGGCGCC
CCCCGGCCGTCGCATGGGCCACGCCGGCGCCATCGTCTCCGGCGGCAAGGGCGGGGCCGACTCCAAGATCAAGGC
TCTCGAGAGCGCCGGCGTCATCGTCGAGCGTTCCCCCGCGAGTCTCGGCAAGGCCCTGTACGATGAGTTTGTCCG
GCGTGATCTTCTGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail