Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03393
Gene name
Locationscaffold_03:2563388..2565453
Strand-
Gene length (bp)2065
Transcript length (bp)1908
Coding sequence length (bp)1908
Protein length (aa) 636

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16199 Radical_SAM_C Radical_SAM C-terminal domain 6.0E-33 325 404
PF04055 Radical_SAM Radical SAM superfamily 2.4E-17 119 307
PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family 7.1E-07 411 549

GO

GO Term Description Terminal node
GO:0051536 iron-sulfur cluster binding Yes
GO:0003824 catalytic activity Yes
GO:0008080 N-acetyltransferase activity Yes
GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups No
GO:0051540 metal cluster binding No
GO:0016410 N-acyltransferase activity No
GO:0016407 acetyltransferase activity No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0016746 acyltransferase activity No
GO:0016740 transferase activity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.6117 0.5151 0.0496 0.0829 0.4879 0.1518 0.125 0.2093 0.1533 0.2704

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1707
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1469
Ophiocordyceps australis map64 (Brazil) OphauB2|6208
Ophiocordyceps camponoti-floridani Ophcf2|03393 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|1260
Ophiocordyceps kimflemingae Ophio5|1979
Ophiocordyceps subramaniannii Hirsu2|1504

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03393
MATATLTARSQASVASESERFLRCCAEVANALIEDHEACNNGRPSRDINLNGLRARLAKKHKLANIPPLTAIIAA
IPEHYKKYILPRLVAKPIRTSSGIAVVAVMCKPHRCPHIAYTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAI
RARYDPFEQARGRVDQLKALGHSVEKVEYIIMGGTFMSLPESYREEFIAQLHNALSGYQTSKVDAAVEASEMSNI
KCVGITIETRPDYCLQPHLSDMLRYGCTRLEVGVQSLYEDVARDTNRGHTVAAVAETFCLAKDAGFKVVSHMMPD
LPNVGMERDMDQFREYFENPAFRTDGLKIYPTLVIRGTGLYELWRTGRYKNYTPNELVDLVARILALVPPWTRIY
RIQRDIPMPLVTSGVENGNLRELALARMKDFGTTCRDVRTREVGINEVKNKIRPNQVELVRRDYVANGGWETFLA
YEDPKQDILVALLRLRKCTTKYSYREEVTTQPSSMIRELHVYGTAVPIHARDPRKFQHQGFGTLLMEEAERIARD
EHGSLKMSVISGVGVRSYYKKLGYWLDGPYMSKWLDGRGERACESWLSGWSFELMLRVDDLRRREWQLMNVAMRD
AIVSEADGALELQMVLVELNRESLTKREAKAILDC*
Coding >Ophcf2|03393
ATGGCCACGGCCACGCTCACCGCGAGGTCGCAGGCGAGCGTCGCCTCCGAGAGCGAGCGCTTCCTACGATGTTGC
GCCGAAGTCGCAAACGCCCTCATCGAAGACCACGAGGCCTGTAACAACGGCCGTCCCTCGCGCGACATCAACCTC
AACGGCCTGCGCGCCAGACTCGCCAAGAAGCACAAGCTCGCCAACATCCCGCCCCTGACGGCCATCATCGCCGCC
ATCCCCGAACACTACAAAAAGTACATCTTACCTCGGCTCGTCGCAAAGCCCATACGCACCTCGTCAGGCATCGCT
GTCGTCGCCGTCATGTGCAAGCCTCATCGATGCCCTCACATCGCTTACACGGGCAACATCTGCGTCTACTGCCCC
GGCGGCCCTGATTCCGACTTTGAATACAGCACGCAATCATACACCGGGTACGAACCGACGTCAATGCGAGCCATC
CGCGCGCGATATGACCCGTTCGAGCAGGCTCGGGGACGAGTCGATCAGCTCAAGGCGCTTGGCCATTCGGTAGAA
AAGGTCGAATACATCATCATGGGCGGCACATTCATGTCGCTGCCCGAATCTTACCGCGAAGAGTTCATCGCCCAG
CTGCACAATGCCTTGAGCGGATATCAGACCTCCAAGGTGGACGCTGCCGTCGAAGCGAGCGAGATGAGCAATATC
AAGTGCGTCGGCATCACCATCGAGACGCGGCCCGATTATTGCCTGCAGCCGCACCTCTCGGACATGCTCAGGTAC
GGCTGCACGAGATTGGAGGTAGGCGTCCAGTCGCTGTACGAAGACGTGGCCCGGGACACGAATCGCGGCCACACC
GTCGCCGCCGTGGCCGAGACCTTTTGTCTGGCCAAAGATGCCGGCTTCAAGGTGGTCAGTCACATGATGCCTGAT
CTACCAAACGTCGGGATGGAGCGGGATATGGACCAGTTCCGGGAGTATTTCGAGAACCCGGCCTTTAGAACGGAC
GGCCTCAAGATCTATCCTACGCTCGTCATCCGCGGCACAGGCTTGTACGAGCTCTGGCGGACGGGAAGATACAAG
AACTACACGCCCAACGAGCTAGTCGATCTAGTGGCCAGGATCCTTGCCCTCGTACCCCCTTGGACGCGAATCTAC
CGCATCCAAAGAGACATTCCTATGCCCCTCGTGACTTCGGGCGTGGAGAACGGCAACCTACGAGAGCTAGCACTG
GCTAGGATGAAGGACTTTGGTACGACGTGTCGAGACGTGCGGACAAGAGAGGTCGGCATCAACGAGGTCAAGAAC
AAGATTCGACCGAACCAAGTGGAGTTGGTGCGTAGAGACTACGTCGCAAACGGCGGCTGGGAGACGTTCCTCGCC
TACGAGGATCCCAAGCAGGACATACTCGTTGCCCTGCTTCGGTTGCGGAAATGCACGACCAAGTATTCCTACCGG
GAAGAGGTGACGACCCAGCCCAGCAGCATGATTCGCGAGTTGCACGTGTACGGCACTGCGGTGCCCATTCACGCG
CGCGACCCGCGCAAGTTTCAGCATCAGGGCTTCGGCACGCTGCTGATGGAGGAGGCGGAGAGGATCGCGCGCGAC
GAGCATGGGAGTCTGAAGATGAGCGTGATATCAGGCGTTGGTGTTCGGAGTTACTACAAGAAGCTTGGGTATTGG
CTTGACGGGCCGTATATGAGCAAGTGGCTCGATGGCCGGGGCGAGCGGGCATGCGAGTCGTGGTTGTCAGGATGG
AGCTTCGAGCTGATGCTCAGGGTCGATGACTTGAGGCGGCGCGAATGGCAACTGATGAATGTGGCAATGCGCGAT
GCCATTGTATCCGAGGCTGATGGTGCTCTCGAGCTTCAAATGGTCTTGGTTGAGCTGAACCGAGAAAGCCTGACC
AAGCGCGAAGCCAAGGCGATCCTTGACTGCTGA
Transcript >Ophcf2|03393
ATGGCCACGGCCACGCTCACCGCGAGGTCGCAGGCGAGCGTCGCCTCCGAGAGCGAGCGCTTCCTACGATGTTGC
GCCGAAGTCGCAAACGCCCTCATCGAAGACCACGAGGCCTGTAACAACGGCCGTCCCTCGCGCGACATCAACCTC
AACGGCCTGCGCGCCAGACTCGCCAAGAAGCACAAGCTCGCCAACATCCCGCCCCTGACGGCCATCATCGCCGCC
ATCCCCGAACACTACAAAAAGTACATCTTACCTCGGCTCGTCGCAAAGCCCATACGCACCTCGTCAGGCATCGCT
GTCGTCGCCGTCATGTGCAAGCCTCATCGATGCCCTCACATCGCTTACACGGGCAACATCTGCGTCTACTGCCCC
GGCGGCCCTGATTCCGACTTTGAATACAGCACGCAATCATACACCGGGTACGAACCGACGTCAATGCGAGCCATC
CGCGCGCGATATGACCCGTTCGAGCAGGCTCGGGGACGAGTCGATCAGCTCAAGGCGCTTGGCCATTCGGTAGAA
AAGGTCGAATACATCATCATGGGCGGCACATTCATGTCGCTGCCCGAATCTTACCGCGAAGAGTTCATCGCCCAG
CTGCACAATGCCTTGAGCGGATATCAGACCTCCAAGGTGGACGCTGCCGTCGAAGCGAGCGAGATGAGCAATATC
AAGTGCGTCGGCATCACCATCGAGACGCGGCCCGATTATTGCCTGCAGCCGCACCTCTCGGACATGCTCAGGTAC
GGCTGCACGAGATTGGAGGTAGGCGTCCAGTCGCTGTACGAAGACGTGGCCCGGGACACGAATCGCGGCCACACC
GTCGCCGCCGTGGCCGAGACCTTTTGTCTGGCCAAAGATGCCGGCTTCAAGGTGGTCAGTCACATGATGCCTGAT
CTACCAAACGTCGGGATGGAGCGGGATATGGACCAGTTCCGGGAGTATTTCGAGAACCCGGCCTTTAGAACGGAC
GGCCTCAAGATCTATCCTACGCTCGTCATCCGCGGCACAGGCTTGTACGAGCTCTGGCGGACGGGAAGATACAAG
AACTACACGCCCAACGAGCTAGTCGATCTAGTGGCCAGGATCCTTGCCCTCGTACCCCCTTGGACGCGAATCTAC
CGCATCCAAAGAGACATTCCTATGCCCCTCGTGACTTCGGGCGTGGAGAACGGCAACCTACGAGAGCTAGCACTG
GCTAGGATGAAGGACTTTGGTACGACGTGTCGAGACGTGCGGACAAGAGAGGTCGGCATCAACGAGGTCAAGAAC
AAGATTCGACCGAACCAAGTGGAGTTGGTGCGTAGAGACTACGTCGCAAACGGCGGCTGGGAGACGTTCCTCGCC
TACGAGGATCCCAAGCAGGACATACTCGTTGCCCTGCTTCGGTTGCGGAAATGCACGACCAAGTATTCCTACCGG
GAAGAGGTGACGACCCAGCCCAGCAGCATGATTCGCGAGTTGCACGTGTACGGCACTGCGGTGCCCATTCACGCG
CGCGACCCGCGCAAGTTTCAGCATCAGGGCTTCGGCACGCTGCTGATGGAGGAGGCGGAGAGGATCGCGCGCGAC
GAGCATGGGAGTCTGAAGATGAGCGTGATATCAGGCGTTGGTGTTCGGAGTTACTACAAGAAGCTTGGGTATTGG
CTTGACGGGCCGTATATGAGCAAGTGGCTCGATGGCCGGGGCGAGCGGGCATGCGAGTCGTGGTTGTCAGGATGG
AGCTTCGAGCTGATGCTCAGGGTCGATGACTTGAGGCGGCGCGAATGGCAACTGATGAATGTGGCAATGCGCGAT
GCCATTGTATCCGAGGCTGATGGTGCTCTCGAGCTTCAAATGGTCTTGGTTGAGCTGAACCGAGAAAGCCTGACC
AAGCGCGAAGCCAAGGCGATCCTTGACTGCTGA
Gene >Ophcf2|03393
ATGGCCACGGCCACGCTCACCGCGAGGTCGCAGGCGAGCGTCGCCTCCGAGAGCGAGCGCTTCCTACGATGTTGC
GCCGAAGTCGCAAACGCCCTCATCGAAGACCACGAGGCCTGTAACAACGGCCGTCCCTCGCGCGACATCAACCTC
AACGGCCTGCGCGCCAGACTCGCCAAGAAGCACAAGCTCGCCAACATCCCGCCCCTGACGGCCATCATCGCCGCC
ATCCCCGAACACTACAAAAAGTACATCTTACCTCGGCTCGTCGCAAAGCCCATACGTAAGGCACCTCTCGGATCA
TCTTGTTCGTCGTCTGATCTGCAGCAGGCACCTCGTCAGGCATCGCTGTCGTCGCCGTCATGTGCAAGCCTCATC
GATGCCCTCACATCGCTTACACGGGCAACATCTGCGTCTACTGCCCCGGCGGCCCTGATTCCGACTTTGAATACA
GCACGCAATCATACACCGGGTACGAACCGACGTCAATGCGAGCCATCCGCGCGCGATATGACCCGTTCGAGCAGG
CTCGGGGACGAGTCGATCAGCTCAAGGCGCTTGGCCATTCGGTAGAAAAGGTCGAATACATCATCATGGGCGGCA
CATTCATGTCGCTGCCCGAATCTTACCGCGAAGAGTTCATCGCCCAGCTGCACAATGCCTTGAGCGGATATCAGA
CCTCCAAGGTGGACGCTGCCGTCGAAGCGAGCGAGATGAGCAATATCAAGTGCGTCGGCATCACCATCGAGACGC
GGCCCGATTATTGCCTGCAGCCGCACCTCTCGGACATGCTCAGGTACGGCTGCACGAGATTGGAGGTAGGCGTCC
AGTCGCTGTACGAAGACGTGGCCCGGGACACGAATCGCGGCCACACCGTCGCCGCCGTGGCCGAGACCTTTTGTC
TGGCCAAAGATGCCGGCTTCAAGGTGGTCAGTCACATGATGCCTGATCTACCAAACGTCGGGATGGAGCGGGATA
TGGACCAGTTCCGGGAGTATTTCGAGAACCCGGCCTTTAGAACGGACGGCCTCAAGATCTATCCTACGCTCGTCA
TCCGCGGCACAGGCTTGTACGAGCTCTGGCGGACGGGAAGATACAAGAACTACACGCCCAACGAGCTAGTCGATC
TAGTGGCCAGGATCCTTGCCCTCGTACCCCCTTGGACGCGAATCTACCGCATCCAAAGAGACATTCCTATGCCCC
TCGTGACTTCGGGCGTGGAGAACGGCAACCTACGAGAGCTAGCACTGGCTAGGATGAAGGACTTTGGTACGACGT
GTCGAGACGTGCGGACAAGAGAGGTCGGCATCAACGAGGTCAAGAACAAGATTCGACCGAACCAAGTGGAGTTGG
TGCGTAGAGACTACGTCGCAAACGGCGGCTGGGAGACGTTCCTCGCCTACGAGGATCCCAAGCAGGACATACTCG
TTGCCCTGCTTCGGTTGCGGAAATGCACGACCAAGTATTCCTACCGGGAAGAGGTGACGACCCAGCCCAGCAGCA
TGATTCGCGAGTTGCACGTGTACGGCACTGCGGTGCCCATTCACGCGCGCGACCCGCGCAAGTTTCAGCATCAGG
GCTTCGGCACGCTGCTGATGGAGGAGGCGGAGAGGATCGCGCGCGACGAGCATGGGAGTCTGAAGATGAGCGTGA
TATCAGGCGTTGGTGTTCGGAGTTACTACAAGAAGCTTGGGTATTGGCTTGACGGGCCGTATATGAGCAAGTGGC
TCGATGGCCGGGGCGAGCGGGCATGCGGTGGATGAGTCGTCGACGACGTGCTCATTGCCGGCTGACGACGGTGTT
GTAGAGTCGTGGTTGTCAGGATGGAGCTTCGAGCTGATGCTCAGGGTCGATGACTTGAGGCGGCGCGAATGGCAA
CTGATGAATGTGGCAATGCGCGATGCCATTGTATCCGAGGCTGATGGGTATGAGGTACATTTCTCATCATAGTGC
TCTCGAGTATGCGGTAGATTCCTATCATAGTGCTCTCGAGCTTCAAATGGTCTTGGTTGAGCTGAACCGAGAAAG
CCTGACCAAGCGCGAAGCCAAGGCGATCCTTGACTGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail