Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03392
Gene name
Locationscaffold_03:2562037..2562870
Strand-
Gene length (bp)833
Transcript length (bp)636
Coding sequence length (bp)636
Protein length (aa) 212

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05529 Bap31 Bap31/Bap29 transmembrane region 1.7E-49 1 140
PF18035 Bap31_Bap29_C Bap31/Bap29 cytoplasmic coiled-coil domain 3.8E-11 162 210

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 7 29 22
2 49 66 17
3 109 131 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03392
MTLYYTLVFILLMFEMGLFMLLLVPLPFNVKRRIFTFISENPLVAKMEYWMKITFFFILILFVDSVNRVYRVQQE
LMAASDQSKGTTTIIGSERLEVQARKFYSQRNMYLCGFTLFLSLILNRTYVMIIQVMRLEDRLKTYEGTNKDTKQ
SEKLAVAGKPGELAALKKELARKEEDLQTLKKQSEQLHKSYDELSDKYAAVQKDKEARKDK*
Coding >Ophcf2|03392
ATGACGCTCTACTACACGCTCGTCTTCATACTGCTCATGTTCGAGATGGGGCTGTTCATGCTCCTTCTCGTGCCG
CTGCCCTTCAATGTCAAGAGGCGGATCTTTACCTTCATCTCGGAGAATCCGTTGGTGGCTAAGATGGAGTATTGG
ATGAAGATTACCTTTTTCTTCATCCTTATTCTATTCGTCGACAGCGTTAATCGTGTGTATCGCGTCCAGCAGGAG
CTCATGGCTGCGTCGGATCAGTCCAAGGGAACCACCACCATCATCGGCTCCGAGCGGCTCGAGGTGCAGGCGCGC
AAGTTTTACTCGCAGCGGAACATGTACCTCTGCGGCTTCACGCTCTTCCTTTCGCTGATCCTGAACCGCACCTAC
GTCATGATCATCCAGGTCATGAGGCTCGAGGACCGGCTCAAGACGTACGAGGGCACCAACAAGGACACCAAGCAG
AGCGAGAAGTTGGCCGTTGCCGGTAAGCCTGGTGAGCTGGCGGCGCTTAAGAAGGAGCTCGCCCGCAAGGAAGAG
GATTTGCAGACGCTCAAGAAGCAGAGCGAGCAGCTCCATAAGAGCTATGACGAGCTGAGCGACAAGTATGCAGCT
GTTCAGAAGGATAAGGAGGCTCGCAAGGATAAATGA
Transcript >Ophcf2|03392
ATGACGCTCTACTACACGCTCGTCTTCATACTGCTCATGTTCGAGATGGGGCTGTTCATGCTCCTTCTCGTGCCG
CTGCCCTTCAATGTCAAGAGGCGGATCTTTACCTTCATCTCGGAGAATCCGTTGGTGGCTAAGATGGAGTATTGG
ATGAAGATTACCTTTTTCTTCATCCTTATTCTATTCGTCGACAGCGTTAATCGTGTGTATCGCGTCCAGCAGGAG
CTCATGGCTGCGTCGGATCAGTCCAAGGGAACCACCACCATCATCGGCTCCGAGCGGCTCGAGGTGCAGGCGCGC
AAGTTTTACTCGCAGCGGAACATGTACCTCTGCGGCTTCACGCTCTTCCTTTCGCTGATCCTGAACCGCACCTAC
GTCATGATCATCCAGGTCATGAGGCTCGAGGACCGGCTCAAGACGTACGAGGGCACCAACAAGGACACCAAGCAG
AGCGAGAAGTTGGCCGTTGCCGGTAAGCCTGGTGAGCTGGCGGCGCTTAAGAAGGAGCTCGCCCGCAAGGAAGAG
GATTTGCAGACGCTCAAGAAGCAGAGCGAGCAGCTCCATAAGAGCTATGACGAGCTGAGCGACAAGTATGCAGCT
GTTCAGAAGGATAAGGAGGCTCGCAAGGATAAATGA
Gene >Ophcf2|03392
ATGACGCTCTACTACACGCTCGTGGGTCGACGCAGCGACGAAAAGCAAGGGCGCTGCTGACGGGAGCTGGCCAGG
TCTTCATACTGCTCATGTTCGAGATGGGGCTGTTCATGCTCCTTCTCGTGCCGCTGCCCTTCAATGTCAAGAGGC
GGATCTTTACGTGCGTCGTGTCGTCTCCTGCGGGGCGTCGGTGGACTGACGAACCGTGGGGGATAGCTTCATCTC
GGAGAATCCGTTGGTGGCTAAGATGGAGTATTGGATGAAGATTACCTTTTTCTTCATCCTTATTCTATTCGTCGA
CAGCGTTAATCGTGTGTATCGCGTCCAGCAGGAGCTCATGGCTGCGTCGGATCAGTCCAAGGGAACGTGGGTGCC
CGGCTCTGCTCTCCACCGTCCGGGTAGACAAGTATGTGATGGTGATGTACGAAGTACGCTGACTCGGAATGTTCG
GCAGCACCACCATCATCGGCTCCGAGCGGCTCGAGGTGCAGGCGCGCAAGTTTTACTCGCAGCGGAACATGTACC
TCTGCGGCTTCACGCTCTTCCTTTCGCTGATCCTGAACCGCACCTACGTCATGATCATCCAGGTCATGAGGCTCG
AGGACCGGCTCAAGACGTACGAGGGCACCAACAAGGACACCAAGCAGAGCGAGAAGTTGGCCGTTGCCGGTAAGC
CTGGTGAGCTGGCGGCGCTTAAGAAGGAGCTCGCCCGCAAGGAAGAGGATTTGCAGACGCTCAAGAAGCAGAGCG
AGCAGCTCCATAAGAGCTATGACGAGCTGAGCGACAAGTATGCAGCTGTTCAGAAGGATAAGGAGGCTCGCAAGG
ATAAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail