Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03375
Gene name
Locationscaffold_03:2513238..2513629
Strand+
Gene length (bp)391
Transcript length (bp)336
Coding sequence length (bp)336
Protein length (aa) 112

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01423 LSM LSM domain 2.2E-09 9 88

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.5516 0.8228 0.0294 0.0217 0.1748 0.0008 0.0173 0.0857 0.0552 0.0107

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1902
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2759
Ophiocordyceps australis map64 (Brazil) OphauB2|4422
Ophiocordyceps camponoti-floridani Ophcf2|03375 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|579
Ophiocordyceps kimflemingae Ophio5|797
Ophiocordyceps subramaniannii Hirsu2|199

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03375
MEPDEAIAYLKALLTKNLRISTTDGRLFWGAFKCTDANQNVVLSHTYEYRQPVSAQGSASHDPFARIDVSAARYL
GLVVVPGHHIVRMELEKFVSQIKTTISQDYDGSLII*
Coding >Ophcf2|03375
ATGGAACCCGACGAGGCAATTGCTTACCTCAAGGCCCTCCTAACCAAGAACCTCAGAATCAGCACCACAGACGGA
CGCCTCTTCTGGGGCGCCTTCAAATGCACCGACGCCAACCAAAACGTCGTCCTATCCCACACGTACGAGTATCGA
CAGCCAGTGTCCGCCCAAGGTTCTGCCTCTCACGACCCTTTTGCCCGGATTGATGTTTCGGCCGCGCGCTATCTC
GGCCTTGTCGTCGTCCCGGGTCATCATATCGTCCGCATGGAGCTGGAGAAGTTCGTGAGCCAGATTAAGACGACG
ATATCACAAGACTACGACGGAAGTCTCATAATATAA
Transcript >Ophcf2|03375
ATGGAACCCGACGAGGCAATTGCTTACCTCAAGGCCCTCCTAACCAAGAACCTCAGAATCAGCACCACAGACGGA
CGCCTCTTCTGGGGCGCCTTCAAATGCACCGACGCCAACCAAAACGTCGTCCTATCCCACACGTACGAGTATCGA
CAGCCAGTGTCCGCCCAAGGTTCTGCCTCTCACGACCCTTTTGCCCGGATTGATGTTTCGGCCGCGCGCTATCTC
GGCCTTGTCGTCGTCCCGGGTCATCATATCGTCCGCATGGAGCTGGAGAAGTTCGTGAGCCAGATTAAGACGACG
ATATCACAAGACTACGACGGAAGTCTCATAATATAA
Gene >Ophcf2|03375
ATGGAACCCGACGAGGCAATTGCTTACCTCAAGGCCCTCCTAACCAAGAACCTCAGAATCAGCACCACAGACGGA
CGCCTCTTCTGGGGCGCCTTCAAATGCACCGACGCCGTTCGTCATCCGCCTCTCCCGTCCCCATTGGAGCGCAGC
TGACCGAACCCAACAGAACCAAAACGTCGTCCTATCCCACACGTACGAGTATCGACAGCCAGTGTCCGCCCAAGG
TTCTGCCTCTCACGACCCTTTTGCCCGGATTGATGTTTCGGCCGCGCGCTATCTCGGCCTTGTCGTCGTCCCGGG
TCATCATATCGTCCGCATGGAGCTGGAGAAGTTCGTGAGCCAGATTAAGACGACGATATCACAAGACTACGACGG
AAGTCTCATAATATAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail