Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03373
Gene name
Locationscaffold_03:2507853..2508974
Strand-
Gene length (bp)1121
Transcript length (bp)897
Coding sequence length (bp)897
Protein length (aa) 299

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07500 TFIIS_M Transcription factor S-II (TFIIS), central domain 7.5E-30 134 244
PF01096 TFIIS_C Transcription factor S-II (TFIIS) 1.6E-17 259 296
PF08711 Med26 TFIIS helical bundle-like domain 9.9E-10 29 79

GO

GO Term Description Terminal node
GO:0008270 zinc ion binding Yes
GO:0003676 nucleic acid binding Yes
GO:0006351 transcription, DNA-templated Yes
GO:0046483 heterocycle metabolic process No
GO:0009059 macromolecule biosynthetic process No
GO:0018130 heterocycle biosynthetic process No
GO:0043170 macromolecule metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0009058 biosynthetic process No
GO:0005488 binding No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0043169 cation binding No
GO:0046914 transition metal ion binding No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:0008152 metabolic process No
GO:1901363 heterocyclic compound binding No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0009987 cellular process No
GO:0044237 cellular metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0008150 biological_process No
GO:0043167 ion binding No
GO:0019438 aromatic compound biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0097659 nucleic acid-templated transcription No
GO:0090304 nucleic acid metabolic process No
GO:0071704 organic substance metabolic process No
GO:0016070 RNA metabolic process No
GO:0046872 metal ion binding No
GO:0006807 nitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0032774 RNA biosynthetic process No
GO:1901360 organic cyclic compound metabolic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.4811 0.5994 0.0202 0.0766 0.1451 0.0157 0.108 0.0657 0.0985 0.0004

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Transcription factor TFIIS

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4956
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2757
Ophiocordyceps australis map64 (Brazil) OphauB2|4424
Ophiocordyceps camponoti-floridani Ophcf2|03373 (this protein)
Ophiocordyceps kimflemingae Ophio5|799
Ophiocordyceps subramaniannii Hirsu2|196

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03373
MDQRELEARVKALTKSVAANEPAENAIRLLDTLKKEAAPTEEMLRATRAGVYVGKLRANPNKEIARAATELVVKW
KKLVEHEKNSKMQKAKKGSPALPVASPPTVAAPLGVKKAFAGDPEKRKFDTDGIDIKRTGSTLRDQCIGLVYNGL
AFRSTEAPSDVVSKASAIEKAVLEVYGSPENADYKKKIRSLFANLKNKSNRELGLRVMSGDITPEQFATMTDEEL
KSEDQRKKDQELERENMKKAQVPMAEKSISDSLECGRCKKKRVSYTQAQTRSADEPMTTFCECMGCGHRWKFS*
Coding >Ophcf2|03373
ATGGACCAACGCGAGCTGGAGGCGCGCGTCAAAGCGCTGACCAAGTCGGTCGCTGCGAATGAACCGGCCGAAAAT
GCCATTAGGCTGCTGGATACGTTGAAGAAGGAGGCTGCTCCCACGGAGGAGATGTTACGAGCCACCCGCGCCGGC
GTCTACGTCGGCAAGTTGCGTGCGAACCCCAACAAAGAAATCGCTCGAGCTGCCACGGAACTCGTGGTCAAGTGG
AAGAAACTCGTGGAGCATGAAAAGAACTCCAAGATGCAAAAGGCCAAGAAGGGATCCCCGGCTCTCCCCGTGGCG
TCGCCCCCGACTGTGGCAGCTCCTTTGGGCGTCAAGAAGGCCTTTGCAGGCGACCCAGAGAAGCGCAAGTTCGAT
ACCGACGGCATCGACATCAAGAGGACCGGCTCGACTCTTCGCGATCAGTGCATCGGACTCGTCTACAATGGCCTT
GCCTTTCGCTCGACCGAGGCCCCTTCGGATGTCGTCTCCAAGGCCTCGGCCATCGAAAAGGCTGTGCTGGAAGTC
TACGGCAGCCCCGAAAACGCAGATTACAAGAAGAAGATACGGTCTCTTTTTGCTAACCTGAAGAACAAGTCGAAC
CGGGAGCTCGGCCTGCGCGTCATGTCGGGCGACATCACGCCCGAGCAATTCGCCACCATGACCGACGAGGAACTC
AAGAGTGAGGACCAGCGCAAGAAGGACCAGGAGCTCGAAAGGGAGAATATGAAGAAGGCGCAGGTGCCCATGGCC
GAGAAGAGCATCAGTGACAGCCTCGAGTGCGGCCGCTGTAAGAAGAAGCGCGTCAGCTACACGCAGGCTCAGACA
CGGAGTGCCGACGAGCCCATGACAACCTTTTGCGAATGCATGGGTTGCGGTCATCGTTGGAAGTTCTCGTGA
Transcript >Ophcf2|03373
ATGGACCAACGCGAGCTGGAGGCGCGCGTCAAAGCGCTGACCAAGTCGGTCGCTGCGAATGAACCGGCCGAAAAT
GCCATTAGGCTGCTGGATACGTTGAAGAAGGAGGCTGCTCCCACGGAGGAGATGTTACGAGCCACCCGCGCCGGC
GTCTACGTCGGCAAGTTGCGTGCGAACCCCAACAAAGAAATCGCTCGAGCTGCCACGGAACTCGTGGTCAAGTGG
AAGAAACTCGTGGAGCATGAAAAGAACTCCAAGATGCAAAAGGCCAAGAAGGGATCCCCGGCTCTCCCCGTGGCG
TCGCCCCCGACTGTGGCAGCTCCTTTGGGCGTCAAGAAGGCCTTTGCAGGCGACCCAGAGAAGCGCAAGTTCGAT
ACCGACGGCATCGACATCAAGAGGACCGGCTCGACTCTTCGCGATCAGTGCATCGGACTCGTCTACAATGGCCTT
GCCTTTCGCTCGACCGAGGCCCCTTCGGATGTCGTCTCCAAGGCCTCGGCCATCGAAAAGGCTGTGCTGGAAGTC
TACGGCAGCCCCGAAAACGCAGATTACAAGAAGAAGATACGGTCTCTTTTTGCTAACCTGAAGAACAAGTCGAAC
CGGGAGCTCGGCCTGCGCGTCATGTCGGGCGACATCACGCCCGAGCAATTCGCCACCATGACCGACGAGGAACTC
AAGAGTGAGGACCAGCGCAAGAAGGACCAGGAGCTCGAAAGGGAGAATATGAAGAAGGCGCAGGTGCCCATGGCC
GAGAAGAGCATCAGTGACAGCCTCGAGTGCGGCCGCTGTAAGAAGAAGCGCGTCAGCTACACGCAGGCTCAGACA
CGGAGTGCCGACGAGCCCATGACAACCTTTTGCGAATGCATGGGTTGCGGTCATCGTTGGAAGTTCTCGTGA
Gene >Ophcf2|03373
ATGGACCAACGCGAGCTGGAGGCGCGCGTCAAAGCGCTGACCAAGTCGGTCGCTGCGAATGAACCGGCCGAAAAT
GCCATTAGGCTGCTGGATACGTTGAAGAAGGAGGCTGCTCCCACGGAGGAGATGTTACGAGTGAGTCACCCCTCT
TTCATGATGATTTTGAAACGGGAAGCTTGTCTTTGGATGCGGTCACGATGAATATATGTTTGCTCTTTCTTATAT
CTTCTCCATCGTCTTCATCTCTTCTTCTATGAGTCTGGGTTGTTTGCTGACGAGCCGATGTCGTTCTTATAGGCC
ACCCGCGCCGGCGTCTACGTCGGCAAGTTGCGTGCGAACCCCAACAAAGAAATCGCTCGAGCTGCCACGGAACTC
GTGGTCAAGTGGAAGAAACTCGTGGAGCATGAAAAGAACTCCAAGATGCAAAAGGCCAAGAAGGGATCCCCGGCT
CTCCCCGTGGCGTCGCCCCCGACTGTGGCAGCTCCTTTGGGCGTCAAGAAGGCCTTTGCAGGCGACCCAGAGAAG
CGCAAGTTCGATACCGACGGCATCGACATCAAGAGGACCGGCTCGACTCTTCGCGATCAGTGCATCGGACTCGTC
TACAATGGCCTTGCCTTTCGCTCGACCGAGGCCCCTTCGGATGTCGTCTCCAAGGCCTCGGCCATCGAAAAGGCT
GTGCTGGAAGTCTACGGCAGCCCCGAAAACGCAGATTACAAGAAGAAGATACGGTCTCTTTTTGCTAACCTGAAG
AACAAGTCGAACCGGGAGCTCGGCCTGCGCGTCATGTCGGGCGACATCACGCCCGAGCAATTCGCCACCATGACC
GACGAGGAACTCAAGAGTGAGGACCAGCGCAAGAAGGACCAGGAGCTCGAAAGGGAGAATATGAAGAAGGCGCAG
GTGCCCATGGCCGAGAAGAGCATCAGTGACAGCCTCGAGTGCGGCCGCTGTAAGAAGAAGCGCGTCAGCTACACG
CAGGCTCAGACACGGAGTGCCGACGAGCCCATGACAACCTTTTGCGAATGCATGGGTTGCGGTCATCGTTGGAAG
GTGAGCGGCATCATTGAGGGAAACTGGCTACGCTTCTACTGACACTCTGTCTTGCCACACAGTTCTCGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail