Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03370
Gene name
Locationscaffold_03:2501049..2504040
Strand+
Gene length (bp)2991
Transcript length (bp)2874
Coding sequence length (bp)2874
Protein length (aa) 958

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01411 tRNA-synt_2c tRNA synthetases class II (A) 5.3E-205 12 591
PF07973 tRNA_SAD Threonyl and Alanyl tRNA synthetase second additional domain 3.2E-15 691 750
PF02272 DHHA1 DHHA1 domain 9.2E-08 844 951

GO

GO Term Description Terminal node
GO:0004813 alanine-tRNA ligase activity Yes
GO:0006419 alanyl-tRNA aminoacylation Yes
GO:0004812 aminoacyl-tRNA ligase activity Yes
GO:0043039 tRNA aminoacylation Yes
GO:0000166 nucleotide binding Yes
GO:0003676 nucleic acid binding Yes
GO:0005524 ATP binding Yes
GO:0046483 heterocycle metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0006520 cellular amino acid metabolic process No
GO:0043170 macromolecule metabolic process No
GO:1901265 nucleoside phosphate binding No
GO:0005488 binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0034660 ncRNA metabolic process No
GO:0071704 organic substance metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0016875 ligase activity, forming carbon-oxygen bonds No
GO:0140098 catalytic activity, acting on RNA No
GO:0043436 oxoacid metabolic process No
GO:0008152 metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0043168 anion binding No
GO:0044237 cellular metabolic process No
GO:0006418 tRNA aminoacylation for protein translation No
GO:0140101 catalytic activity, acting on a tRNA No
GO:0019752 carboxylic acid metabolic process No
GO:0006399 tRNA metabolic process No
GO:0009987 cellular process No
GO:0090304 nucleic acid metabolic process No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0097367 carbohydrate derivative binding No
GO:0030554 adenyl nucleotide binding No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0008150 biological_process No
GO:0043167 ion binding No
GO:0006082 organic acid metabolic process No
GO:0036094 small molecule binding No
GO:0032555 purine ribonucleotide binding No
GO:0043038 amino acid activation No
GO:0003824 catalytic activity No
GO:0017076 purine nucleotide binding No
GO:0032553 ribonucleotide binding No
GO:0003674 molecular_function No
GO:0016070 RNA metabolic process No
GO:0016874 ligase activity No
GO:0006807 nitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0044281 small molecule metabolic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus 0.6506 0.5815 0.0703 0.0273 0.2697 0.0981 0.1073 0.0759 0.0853 0.0662

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1977
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2754
Ophiocordyceps australis map64 (Brazil) OphauB2|4427
Ophiocordyceps camponoti-floridani Ophcf2|03370 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|583
Ophiocordyceps kimflemingae Ophio5|2261
Ophiocordyceps subramaniannii Hirsu2|2171

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03370
MSRDVEWPASRVRKTFFDFFAQRGHTIVPSGSVVPHNDATLLFTNAGMNQFKPIFLGTVGRSDPMAGLKRAADSQ
KVIRAGGKHNDLDDVGKDSYHHTFFEMLGNWSFGDYFKAEAIAMAWELLTRVYGLDPARLYVTYFEGNDGLGLDP
DLEARDLWKAIGVPEHHILPGNMRDNFWEMGDQGPCGPCSEVHYDKMGGGRDASKLVNEDDPMVVEIWNIVFIQF
DRQKDKSLKPLPAKHVDTGMGYERLVSALQDTKSNYATDCFTPLFDRIQLVTGVRPYSDKYGKDDVDGIDTAYRV
VADHIRTLSFAIADGAVPNNDGRGYVIRRILRRGVRYARKYLNADIGSFFSKILPALIDHVGDQFPELVSKRNDL
VEILDEEEEAFSRTLDRGEAQFEKHAAKAASRDDKKLDGDTVWRLYDTFGFPVDLTRIMADERGLVMDDVEVEAA
RERAREASKAVKDAVDTFAKLDVHQIAELEQRRGIARTDDDAKFIRGNCKAKVQLISDGKSFHSSTRELPPNSPL
GLLLDRTNFYAESGGQVADTGRIVVDGMAEFKVLDVQNYGGYVLHSGFISYGVLSAGDGVVCAYEELRRDPIRHN
HSGTHVLNHALREVLGDDVKQKGSLVDDEKLRFDFSHKCQVKLDELRRIEELANAYIDRDEEVFSKDVDLHLARQ
INGVRAVFGETYPNPVRVVSLGADIEAMLADPSLPEWRRYSVEFCGGTHVDRTSNIKHLVIVEEGGIAKGTRRIV
ALTGDSANRVQRSAIAYQTTLQSLDALPPGPKKEARVREVSQELGRLVVSTLDKDVLNRRFRDISAAVAAEQKSR
HRAEAKAALDAALGHFAVEGEERRMWFVGRVPIGANAKAVGEVVRYFQGKDGERSVYVLAGDGEGVVHAVYVGKH
LSQRGVTAEEWSSVVTAVVGGRSGGKEPVRQGQGTKPEMVDEGVEVAERWLREKLKL*
Coding >Ophcf2|03370
ATGAGCCGCGACGTCGAATGGCCCGCCTCTCGAGTGCGCAAGACCTTCTTCGACTTCTTCGCTCAGCGAGGCCAT
ACCATCGTCCCCTCTGGCTCCGTCGTGCCTCACAATGATGCCACGCTTCTCTTCACCAACGCGGGCATGAATCAG
TTCAAGCCCATCTTTCTCGGTACCGTTGGTCGTTCTGATCCTATGGCTGGTCTCAAGCGTGCCGCCGATTCGCAA
AAGGTGATTCGCGCGGGGGGCAAGCACAACGACCTCGATGACGTTGGCAAGGATAGCTATCATCATACTTTTTTC
GAGATGCTGGGCAACTGGTCCTTTGGAGACTACTTCAAAGCCGAGGCCATCGCCATGGCCTGGGAGCTTCTCACA
CGCGTATATGGGCTTGACCCGGCTCGTCTCTACGTCACCTACTTCGAGGGCAACGACGGTCTCGGCCTCGACCCG
GATCTCGAGGCCAGGGACCTGTGGAAGGCCATTGGCGTCCCGGAGCATCACATCCTGCCGGGAAACATGCGCGAC
AACTTCTGGGAGATGGGTGATCAGGGTCCCTGCGGTCCCTGCAGCGAGGTCCACTACGACAAGATGGGCGGTGGC
CGCGACGCTTCCAAGCTCGTCAACGAAGATGATCCGATGGTGGTGGAGATTTGGAACATTGTCTTCATCCAGTTC
GATCGGCAGAAGGACAAGTCGTTGAAGCCCCTTCCGGCCAAGCACGTCGACACGGGCATGGGCTACGAGCGGCTC
GTCTCGGCCCTGCAGGACACAAAGTCCAACTACGCTACCGACTGCTTCACGCCGCTCTTCGACCGCATCCAGCTC
GTCACCGGCGTCAGGCCCTACTCGGATAAGTACGGTAAAGACGATGTCGACGGCATCGACACCGCCTACCGCGTC
GTCGCCGATCATATCCGCACTCTGTCCTTTGCCATCGCCGACGGCGCCGTGCCCAACAACGACGGCCGGGGCTAC
GTCATCCGCCGCATCCTCCGCCGTGGCGTCCGTTACGCCCGCAAGTACCTCAACGCCGACATCGGTTCCTTCTTT
TCCAAGATCCTACCGGCCCTCATCGATCACGTGGGCGACCAGTTCCCCGAACTGGTCAGCAAGAGGAACGACCTG
GTGGAGATTCTCGACGAGGAGGAGGAGGCCTTTTCCCGCACCCTCGATCGGGGTGAGGCTCAGTTCGAGAAGCAC
GCGGCCAAGGCGGCCTCCAGGGACGACAAGAAGCTCGACGGCGATACCGTCTGGCGCCTGTACGATACCTTTGGC
TTCCCTGTCGACCTGACGAGGATCATGGCCGACGAGCGCGGACTGGTGATGGACGACGTCGAGGTCGAAGCCGCG
CGCGAGAGGGCACGCGAAGCCAGCAAAGCCGTCAAAGACGCCGTCGACACCTTTGCCAAGCTCGACGTCCACCAA
ATCGCCGAACTGGAGCAGCGTCGAGGCATCGCCCGCACTGACGATGACGCCAAGTTTATCCGCGGCAACTGCAAG
GCAAAGGTTCAGCTCATCTCGGACGGCAAGTCCTTTCACTCCTCCACGCGAGAGCTCCCGCCAAACTCGCCCCTC
GGCCTCCTCCTGGACAGGACAAACTTTTACGCCGAGTCCGGCGGACAGGTGGCGGACACGGGCCGGATCGTCGTG
GACGGCATGGCAGAGTTCAAGGTGTTGGACGTGCAGAATTACGGAGGATACGTCCTCCACAGCGGCTTCATCAGC
TACGGCGTCCTCTCGGCCGGAGACGGCGTCGTCTGCGCGTACGAAGAGCTCCGTCGGGACCCCATCCGGCACAAC
CACAGCGGCACGCACGTGCTCAACCACGCGCTGCGAGAGGTGCTGGGCGACGACGTCAAGCAAAAGGGCTCGCTG
GTGGACGACGAGAAGCTCCGTTTCGACTTCTCGCACAAGTGTCAGGTCAAGCTGGACGAGCTCCGGCGGATAGAA
GAGCTCGCCAACGCCTACATCGACCGCGACGAAGAGGTGTTTTCCAAGGACGTGGACCTCCATCTCGCCCGTCAG
ATCAATGGCGTCCGCGCCGTCTTCGGAGAAACCTACCCCAATCCGGTCCGCGTCGTCTCCCTGGGCGCCGACATC
GAAGCCATGCTCGCCGATCCATCCCTCCCCGAATGGCGGAGATACAGCGTCGAGTTCTGCGGAGGCACCCACGTC
GACCGGACGAGCAACATCAAGCACCTCGTCATCGTCGAAGAAGGCGGCATCGCAAAGGGAACCCGTCGAATAGTC
GCCTTGACGGGCGATTCCGCGAACCGAGTCCAACGCTCGGCAATCGCCTACCAAACCACGCTCCAGAGTCTCGAC
GCCCTGCCCCCCGGTCCCAAGAAGGAGGCCCGCGTCAGGGAAGTCTCGCAGGAGCTCGGCCGGCTCGTCGTCTCG
ACGCTCGACAAGGACGTCCTCAACCGGCGCTTCCGCGACATCTCGGCGGCCGTGGCGGCGGAGCAGAAGTCGAGG
CACAGGGCCGAGGCCAAGGCCGCGCTCGATGCCGCGCTGGGGCATTTCGCCGTCGAAGGGGAGGAGAGGAGGATG
TGGTTCGTCGGGAGGGTGCCCATCGGGGCGAATGCCAAGGCCGTGGGCGAGGTGGTGCGGTATTTCCAGGGGAAG
GACGGGGAGAGGTCCGTGTACGTGCTGGCCGGAGATGGCGAGGGCGTGGTCCACGCCGTCTACGTCGGAAAGCAT
CTCTCCCAACGCGGCGTCACGGCCGAGGAGTGGTCCTCGGTCGTGACGGCCGTCGTCGGCGGTCGGTCGGGGGGC
AAAGAGCCGGTCAGGCAGGGACAGGGGACGAAGCCCGAGATGGTGGACGAGGGAGTCGAGGTTGCCGAGAGGTGG
TTGCGGGAAAAGCTGAAGCTGTGA
Transcript >Ophcf2|03370
ATGAGCCGCGACGTCGAATGGCCCGCCTCTCGAGTGCGCAAGACCTTCTTCGACTTCTTCGCTCAGCGAGGCCAT
ACCATCGTCCCCTCTGGCTCCGTCGTGCCTCACAATGATGCCACGCTTCTCTTCACCAACGCGGGCATGAATCAG
TTCAAGCCCATCTTTCTCGGTACCGTTGGTCGTTCTGATCCTATGGCTGGTCTCAAGCGTGCCGCCGATTCGCAA
AAGGTGATTCGCGCGGGGGGCAAGCACAACGACCTCGATGACGTTGGCAAGGATAGCTATCATCATACTTTTTTC
GAGATGCTGGGCAACTGGTCCTTTGGAGACTACTTCAAAGCCGAGGCCATCGCCATGGCCTGGGAGCTTCTCACA
CGCGTATATGGGCTTGACCCGGCTCGTCTCTACGTCACCTACTTCGAGGGCAACGACGGTCTCGGCCTCGACCCG
GATCTCGAGGCCAGGGACCTGTGGAAGGCCATTGGCGTCCCGGAGCATCACATCCTGCCGGGAAACATGCGCGAC
AACTTCTGGGAGATGGGTGATCAGGGTCCCTGCGGTCCCTGCAGCGAGGTCCACTACGACAAGATGGGCGGTGGC
CGCGACGCTTCCAAGCTCGTCAACGAAGATGATCCGATGGTGGTGGAGATTTGGAACATTGTCTTCATCCAGTTC
GATCGGCAGAAGGACAAGTCGTTGAAGCCCCTTCCGGCCAAGCACGTCGACACGGGCATGGGCTACGAGCGGCTC
GTCTCGGCCCTGCAGGACACAAAGTCCAACTACGCTACCGACTGCTTCACGCCGCTCTTCGACCGCATCCAGCTC
GTCACCGGCGTCAGGCCCTACTCGGATAAGTACGGTAAAGACGATGTCGACGGCATCGACACCGCCTACCGCGTC
GTCGCCGATCATATCCGCACTCTGTCCTTTGCCATCGCCGACGGCGCCGTGCCCAACAACGACGGCCGGGGCTAC
GTCATCCGCCGCATCCTCCGCCGTGGCGTCCGTTACGCCCGCAAGTACCTCAACGCCGACATCGGTTCCTTCTTT
TCCAAGATCCTACCGGCCCTCATCGATCACGTGGGCGACCAGTTCCCCGAACTGGTCAGCAAGAGGAACGACCTG
GTGGAGATTCTCGACGAGGAGGAGGAGGCCTTTTCCCGCACCCTCGATCGGGGTGAGGCTCAGTTCGAGAAGCAC
GCGGCCAAGGCGGCCTCCAGGGACGACAAGAAGCTCGACGGCGATACCGTCTGGCGCCTGTACGATACCTTTGGC
TTCCCTGTCGACCTGACGAGGATCATGGCCGACGAGCGCGGACTGGTGATGGACGACGTCGAGGTCGAAGCCGCG
CGCGAGAGGGCACGCGAAGCCAGCAAAGCCGTCAAAGACGCCGTCGACACCTTTGCCAAGCTCGACGTCCACCAA
ATCGCCGAACTGGAGCAGCGTCGAGGCATCGCCCGCACTGACGATGACGCCAAGTTTATCCGCGGCAACTGCAAG
GCAAAGGTTCAGCTCATCTCGGACGGCAAGTCCTTTCACTCCTCCACGCGAGAGCTCCCGCCAAACTCGCCCCTC
GGCCTCCTCCTGGACAGGACAAACTTTTACGCCGAGTCCGGCGGACAGGTGGCGGACACGGGCCGGATCGTCGTG
GACGGCATGGCAGAGTTCAAGGTGTTGGACGTGCAGAATTACGGAGGATACGTCCTCCACAGCGGCTTCATCAGC
TACGGCGTCCTCTCGGCCGGAGACGGCGTCGTCTGCGCGTACGAAGAGCTCCGTCGGGACCCCATCCGGCACAAC
CACAGCGGCACGCACGTGCTCAACCACGCGCTGCGAGAGGTGCTGGGCGACGACGTCAAGCAAAAGGGCTCGCTG
GTGGACGACGAGAAGCTCCGTTTCGACTTCTCGCACAAGTGTCAGGTCAAGCTGGACGAGCTCCGGCGGATAGAA
GAGCTCGCCAACGCCTACATCGACCGCGACGAAGAGGTGTTTTCCAAGGACGTGGACCTCCATCTCGCCCGTCAG
ATCAATGGCGTCCGCGCCGTCTTCGGAGAAACCTACCCCAATCCGGTCCGCGTCGTCTCCCTGGGCGCCGACATC
GAAGCCATGCTCGCCGATCCATCCCTCCCCGAATGGCGGAGATACAGCGTCGAGTTCTGCGGAGGCACCCACGTC
GACCGGACGAGCAACATCAAGCACCTCGTCATCGTCGAAGAAGGCGGCATCGCAAAGGGAACCCGTCGAATAGTC
GCCTTGACGGGCGATTCCGCGAACCGAGTCCAACGCTCGGCAATCGCCTACCAAACCACGCTCCAGAGTCTCGAC
GCCCTGCCCCCCGGTCCCAAGAAGGAGGCCCGCGTCAGGGAAGTCTCGCAGGAGCTCGGCCGGCTCGTCGTCTCG
ACGCTCGACAAGGACGTCCTCAACCGGCGCTTCCGCGACATCTCGGCGGCCGTGGCGGCGGAGCAGAAGTCGAGG
CACAGGGCCGAGGCCAAGGCCGCGCTCGATGCCGCGCTGGGGCATTTCGCCGTCGAAGGGGAGGAGAGGAGGATG
TGGTTCGTCGGGAGGGTGCCCATCGGGGCGAATGCCAAGGCCGTGGGCGAGGTGGTGCGGTATTTCCAGGGGAAG
GACGGGGAGAGGTCCGTGTACGTGCTGGCCGGAGATGGCGAGGGCGTGGTCCACGCCGTCTACGTCGGAAAGCAT
CTCTCCCAACGCGGCGTCACGGCCGAGGAGTGGTCCTCGGTCGTGACGGCCGTCGTCGGCGGTCGGTCGGGGGGC
AAAGAGCCGGTCAGGCAGGGACAGGGGACGAAGCCCGAGATGGTGGACGAGGGAGTCGAGGTTGCCGAGAGGTGG
TTGCGGGAAAAGCTGAAGCTGTGA
Gene >Ophcf2|03370
ATGAGCCGCGACGTCGAATGGCCCGCCTCTCGAGTGCGCAAGACCTTCTTCGACTTCTTCGCTCAGCGAGGCCAT
ACCATCGTCCCCTCTGGCTCCGTCGTGCCTCACAATGATGCCACGCTTCTCTTCACCAACGCGGGCATGAATCAG
TTCAAGCCCATCTTTCTCGGTACCGTTGGTCGTTCTGATCCTATGGCTGGTCTCAAGCGTGCCGCCGATTCGCAA
AAGGTGATTCGCGCGGGGGGCAAGCACAACGACCTCGATGACGTTGGCAAGGATAGCTATCATCATACTTTTTTC
GAGATGCTGGGCAACTGGTCCTTTGGAGACTACTTCAAAGCCGAGGCCATCGCCATGGCCTGGGAGCTTCTCACA
CGCGTATATGGGCTTGACCCGGCTCGTCTCTACGTCACCTACTTCGAGGGCAACGACGGTCTCGGCCTCGACCCG
GATCTCGAGGCCAGGGACCTGTGGAAGGCCATTGGCGTCCCGGAGCATCACATCCTGCCGGGAAACATGCGCGAC
AACTTCTGGGAGATGGGTGATCAGGGTCCCTGCGGTCCCTGCAGCGAGGTCCACTACGACAAGATGGGCGGTGGC
CGCGACGCTTCCAAGCTCGTCAACGAAGATGATCCGATGGTGGTGGAGATTTGGAACATTGTCTTCATCCAGTTC
GATCGGCAGAAGGACAAGTCGTTGAAGCCCCTTCCGGCCAAGCACGTCGACACGGGCATGGGCTACGAGCGGCTC
GTCTCGGCCCTGCAGGACACAAAGTCCAACTACGCTACCGACTGCTTCACGCCGCTCTTCGACCGCATCCAGCTC
GTCACCGGCGTCAGGCCCTACTCGGATAAGTACGGTAAAGACGATGTCGACGGCATCGACACCGCCTACCGCGTC
GTCGCCGATCATATCCGCACTCTGTCCTTTGCCATCGCCGACGGCGCCGTGCCCAACAACGACGGCCGGGGCTAC
GTCATCCGCCGCATCCTCCGCCGTGGCGTCCGTTACGCCCGCAAGTACCTCAACGCCGACATCGGTTCCTTCTTT
TCCAAGATCCTACCGGCCCTCATCGATCACGTGGGCGACCAGTTCCCCGAACTGGTCAGCAAGAGGAACGACCTG
GTGGAGATTCTCGACGAGGAGGAGGAGGCCTTTTCCCGCACCCTCGATCGGGGTGAGGCTCAGTTCGAGAAGCAC
GCGGCCAAGGCGGCCTCCAGGGACGACAAGAAGCTCGACGGCGATACCGTCTGGCGCCTGTACGATACCTTTGGC
TTCCCTGTCGACCTGACGAGGATCATGGCCGACGAGCGCGGACTGGTGATGGACGACGTCGAGGTCGAAGCCGCG
CGCGAGAGGGCACGCGAAGCCAGCAAAGCCGTCAAAGACGCCGTCGACACCTTTGCCAAGCTCGACGTCCACCAA
ATCGCCGAACTGGAGCAGCGTCGAGGCATCGCCCGCACTGACGATGACGCCAAGTTTATCCGCGGCAACTGCAAG
GCAAAGGTTCAGCTCATCTCGGACGGCAAGTCCTTTCACTCCTCCACGCGAGAGCTCCCGCCAAACTCGCCCCTC
GGCCTCCTCCTGGACAGGACAAACTTTTACGCCGAGTCCGGCGGACAGGTGGCGGACACGGGCCGGATCGTCGTG
GACGGCATGGCAGAGTTCAAGGTGTTGGACGTGCAGAATTACGGAGGATACGTCCTCCACAGCGGCTTCATCAGC
TACGGCGTCCTCTCGGCCGGAGACGGCGTCGTCTGCGCGTACGAAGAGCTCCGTCGGGACCCCATCCGGCACAAC
CACAGCGGCACGCACGTGCTCAACCACGCGCTGCGAGAGGTGCTGGGCGACGACGTCAAGCAAAAGGGCTCGCTG
GTGGACGACGAGAAGCTCCGTTTCGACTTCTCGCACAAGTGTCAGGTCAAGCTGGACGAGCTCCGGCGGATAGAA
GAGCTCGCCAACGCCTACATCGACCGCGACGAAGAGGTGTTTTCCAAGGACGTGGACCTCCATCTCGCCCGTCAG
ATCAATGGCGTCCGCGCCGTCTTCGGAGAAACCTACCCCAATCCGGTCCGCGTCGTCTCCCTGGGCGCCGACATC
GAAGCCATGCTCGCCGATCCATCCCTCCCCGAATGGCGGAGATACAGCGTCGAGTTCTGCGGAGGCACCCACGTC
GACCGGACGAGCAACATCAAGCACCTCGTCATCGTCGAAGAAGGCGGCATCGCAAAGGGAACCCGTCGAATAGTC
GCCTTGACGGGCGATTCCGCGAACCGAGTCCAACGCTCGGCAATCGCCTACCAAACCACGCTCCAGAGTCTCGAC
GCCCTGCCCCCCGGTCCCAAGAAGGAGGCCCGCGTCAGGGAAGTCTCGCAGGAGCTCGGCCGGCTCGTCGTCTCG
ACGCTCGACAAGGACGTCCTCAACCGGCGCTTCCGCGACATCTCGGCGGCCGTGGCGGCGGAGCAGAAGTCGAGG
CACAGGGCCGAGGCCAAGGCCGCGCTCGATGCCGCGCTGGGGCATTTCGCCGTCGAAGGGGAGGAGAGGAGGATG
TGGTTCGTCGGGAGGGTGCCCATCGGGGCGAATGCCAAGGCCGTGGGCGAGGTGGTGCGGTATTTCCAGGGGAAG
GACGGGGAGAGGTCCGTGTACGTGCTGGCCGGAGATGGCGAGGGCGTGGTCCACGCCGTCTACGTCGGAAAGGTG
AGTCTTGTTTTTTTTTCTTTTTTTTTCTTTGTTTTCTCTTGTTCTTGTTCTTGTTCTTGTTCTTGTTCTTGTTCT
TCCCCTTCCCCACGACCGCGCACAGCTAACCAAAGACAGCATCTCTCCCAACGCGGCGTCACGGCCGAGGAGTGG
TCCTCGGTCGTGACGGCCGTCGTCGGCGGTCGGTCGGGGGGCAAAGAGCCGGTCAGGCAGGGACAGGGGACGAAG
CCCGAGATGGTGGACGAGGGAGTCGAGGTTGCCGAGAGGTGGTTGCGGGAAAAGCTGAAGCTGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail