Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03367
Gene name
Locationscaffold_03:2495135..2497897
Strand+
Gene length (bp)2762
Transcript length (bp)2487
Coding sequence length (bp)2487
Protein length (aa) 829

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08238 Sel1 Sel1 repeat 7.9E+01 129 141
PF08238 Sel1 Sel1 repeat 1.9E+01 142 174
PF08238 Sel1 Sel1 repeat 2.7E-06 182 217
PF08238 Sel1 Sel1 repeat 5.2E+00 222 250
PF08238 Sel1 Sel1 repeat 5.7E-03 323 351
PF08238 Sel1 Sel1 repeat 9.2E-03 383 413
PF08238 Sel1 Sel1 repeat 6.2E-03 414 448
PF08238 Sel1 Sel1 repeat 3.7E+00 451 484
PF08238 Sel1 Sel1 repeat 8.2E-03 607 634
PF08238 Sel1 Sel1 repeat 2.8E-04 643 670

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Endoplasmic reticulum Signal peptide 0.3037 0.1235 0.4595 0.1422 0.3202 0.0241 0.6526 0.2649 0.3962 0.0352

SignalP

SignalP signal predicted Location Score
Yes 1 - 19 0.999723

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3083
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4202
Ophiocordyceps australis map64 (Brazil) OphauB2|4430
Ophiocordyceps camponoti-floridani Ophcf2|03367 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|1134
Ophiocordyceps kimflemingae Ophio5|2258
Ophiocordyceps subramaniannii Hirsu2|5354

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03367
MKVPTVWLLLLWQAATVLGTNAQYYRDTHTDRAVRRESKDHGLGTKAEAAADDEEQAQPIIPQPGADLVNAAIAE
LRTMPRSAHARRRQSSGLISFAFRYIMKTIPTRPASAPTREKQAKPPGGASLHAVELLQQAADQNNSDALLMLAE
FNFFGNHSHPRNLDVAFRNYKKLAVHHGNTTAQYMLGLFHSTGIGGVVPRDQAKALLYYTFAAARGDTRAEMATA
FRHHNGIGAVKDCETAVKYYKRVADKAIEWYRSGPPGGMSWVHQSWRISDDEGGIYGEGASVSSSGINSRKASPH
SDAHAAIGDVIEYLDLVSQKGDSKASYNLGRIYYEGQRGLEKDFDLARRYFFLVASRYWKRDSRIVENHTKEIEK
MAAKAAGFIGRMYLRGDGVVQNPDRAKVWFDRGISLGDAQSQYGRGLMLLNGLGGKENVKLAMELFAASANQDYA
PAQVQMGRLYLDQGGPDDVRIANNHFELAARHGNMEAHHYLAEMVYNGVGREKLCGVSLSYYKTVAEKAEPLVSS
WADANEAYEAGDLDLALLGYLMAAEQGYEKAQTNVAYMLDPLRSRMAVTGWKRRATDEGSLLNNAGLALIYWTRS
SRQSNVDALVKMGDYYFYGIGTGRDVGKAVQCYTGASDYSQSAQALYNLGWMHENGLGLTQDFHLAKRYYDHALE
VNEEAYLPVTLSLLKLRVRSAWNTLTHGPIHSIQDEPKKGKDWSLAEWIANFLEDDTLSYEAEAREQDSLEGGGM
GGGRMRRWKTGGAGERADYRGDDGAAGGGNDEVDIGGDGNGGHGNGHGNGNGNGNGNGNGNGNGVDGFREWAAGG
AMP*
Coding >Ophcf2|03367
ATGAAGGTTCCGACCGTCTGGCTGCTCTTGCTTTGGCAGGCTGCCACGGTATTGGGCACCAACGCTCAGTACTAT
CGCGATACGCATACTGATAGAGCCGTTCGTCGTGAATCGAAAGACCATGGCCTCGGTACGAAAGCGGAGGCCGCT
GCCGACGATGAGGAACAGGCCCAGCCCATCATCCCGCAGCCAGGTGCCGACCTCGTCAATGCCGCCATCGCCGAG
CTCCGGACGATGCCGCGATCCGCGCACGCCCGGCGCCGACAGTCGTCGGGCCTCATTAGCTTTGCCTTTCGCTAC
ATCATGAAGACGATCCCGACGAGGCCCGCTTCGGCGCCGACGCGGGAAAAGCAGGCTAAGCCCCCCGGCGGCGCC
TCCCTCCATGCCGTTGAGCTACTTCAGCAGGCTGCCGATCAGAATAACTCGGATGCCCTGCTCATGCTGGCCGAG
TTCAACTTTTTCGGCAACCACAGCCACCCTCGAAACCTCGATGTCGCTTTTCGCAACTACAAGAAGCTGGCAGTC
CATCACGGCAACACGACGGCGCAGTACATGCTGGGCCTCTTCCACTCGACCGGCATCGGCGGTGTCGTCCCCCGC
GACCAAGCCAAGGCCCTCCTCTACTACACCTTCGCCGCCGCTAGAGGCGACACTCGTGCGGAGATGGCTACGGCC
TTTCGGCACCACAATGGGATAGGCGCCGTCAAGGACTGCGAGACTGCCGTCAAGTACTATAAGCGAGTGGCCGAC
AAGGCCATTGAGTGGTATCGCTCAGGCCCTCCCGGCGGCATGTCGTGGGTGCACCAGAGCTGGCGCATCTCGGAC
GACGAAGGAGGCATCTACGGCGAGGGCGCCAGCGTTTCCAGCTCCGGCATCAACTCGCGCAAGGCGAGCCCTCAC
TCGGACGCGCACGCGGCCATCGGCGACGTGATCGAATACCTGGACCTGGTTTCGCAAAAGGGCGACTCCAAGGCG
TCGTATAACCTCGGACGCATCTACTACGAAGGCCAACGGGGTCTCGAAAAGGACTTTGACCTGGCGCGACGGTAC
TTTTTCTTGGTGGCGTCTCGGTATTGGAAGAGGGACAGCCGGATCGTGGAGAACCACACCAAAGAGATTGAAAAG
ATGGCGGCCAAGGCGGCCGGCTTCATTGGGCGCATGTACCTCCGGGGCGACGGTGTGGTGCAGAATCCGGACCGG
GCCAAGGTCTGGTTCGACCGGGGCATCTCGCTGGGCGACGCGCAGTCGCAGTACGGGCGCGGCCTGATGCTACTC
AACGGGCTGGGCGGCAAGGAGAACGTCAAGCTGGCCATGGAGCTGTTTGCGGCCTCGGCCAACCAAGACTACGCG
CCGGCGCAGGTGCAGATGGGCCGTCTGTACCTAGACCAGGGAGGGCCGGACGACGTGCGCATCGCCAACAATCAC
TTTGAGCTCGCGGCGCGACACGGCAACATGGAGGCGCACCACTACCTGGCCGAGATGGTGTACAACGGCGTGGGC
AGGGAGAAGCTCTGCGGCGTGTCACTGAGTTACTACAAGACGGTGGCGGAGAAGGCGGAGCCGCTGGTATCGTCG
TGGGCAGACGCCAACGAGGCGTACGAGGCCGGCGACCTGGACCTCGCCCTCCTCGGCTACCTGATGGCGGCGGAG
CAGGGGTACGAAAAGGCGCAGACCAACGTGGCCTACATGCTGGACCCTCTGCGATCGCGGATGGCGGTGACGGGG
TGGAAGCGAAGGGCGACGGACGAGGGCAGCCTGCTCAACAACGCCGGGCTGGCCCTCATTTACTGGACGCGGTCG
TCGCGACAGTCCAACGTGGACGCGCTGGTCAAGATGGGAGACTACTACTTTTACGGCATCGGGACGGGGCGCGAC
GTGGGCAAGGCGGTGCAGTGCTACACGGGGGCGTCGGACTACTCCCAGAGCGCGCAGGCGCTCTATAACCTGGGC
TGGATGCACGAGAACGGGCTGGGGCTGACGCAGGACTTTCACCTGGCGAAGCGCTACTACGACCACGCGCTCGAG
GTCAACGAGGAGGCGTATCTACCGGTGACGCTGAGCCTGCTGAAGTTACGGGTGCGCAGCGCGTGGAACACGCTG
ACGCACGGGCCGATCCATTCGATCCAGGACGAGCCGAAGAAGGGCAAGGACTGGTCGCTGGCGGAGTGGATCGCC
AACTTTCTCGAGGACGACACGCTGTCGTACGAGGCCGAGGCGCGCGAGCAGGACAGCCTGGAGGGGGGCGGGATG
GGCGGCGGGAGGATGCGTCGCTGGAAGACGGGGGGTGCTGGAGAGCGTGCTGATTATCGGGGTGACGACGGCGCT
GCGGGGGGAGGCAACGATGAGGTCGACATCGGGGGCGACGGGAACGGCGGCCACGGCAACGGCCACGGCAACGGC
AACGGCAACGGCAACGGCAACGGCAACGGCAACGGCAACGGCGTCGACGGCTTCCGGGAGTGGGCGGCGGGAGGG
GCGATGCCGTGA
Transcript >Ophcf2|03367
ATGAAGGTTCCGACCGTCTGGCTGCTCTTGCTTTGGCAGGCTGCCACGGTATTGGGCACCAACGCTCAGTACTAT
CGCGATACGCATACTGATAGAGCCGTTCGTCGTGAATCGAAAGACCATGGCCTCGGTACGAAAGCGGAGGCCGCT
GCCGACGATGAGGAACAGGCCCAGCCCATCATCCCGCAGCCAGGTGCCGACCTCGTCAATGCCGCCATCGCCGAG
CTCCGGACGATGCCGCGATCCGCGCACGCCCGGCGCCGACAGTCGTCGGGCCTCATTAGCTTTGCCTTTCGCTAC
ATCATGAAGACGATCCCGACGAGGCCCGCTTCGGCGCCGACGCGGGAAAAGCAGGCTAAGCCCCCCGGCGGCGCC
TCCCTCCATGCCGTTGAGCTACTTCAGCAGGCTGCCGATCAGAATAACTCGGATGCCCTGCTCATGCTGGCCGAG
TTCAACTTTTTCGGCAACCACAGCCACCCTCGAAACCTCGATGTCGCTTTTCGCAACTACAAGAAGCTGGCAGTC
CATCACGGCAACACGACGGCGCAGTACATGCTGGGCCTCTTCCACTCGACCGGCATCGGCGGTGTCGTCCCCCGC
GACCAAGCCAAGGCCCTCCTCTACTACACCTTCGCCGCCGCTAGAGGCGACACTCGTGCGGAGATGGCTACGGCC
TTTCGGCACCACAATGGGATAGGCGCCGTCAAGGACTGCGAGACTGCCGTCAAGTACTATAAGCGAGTGGCCGAC
AAGGCCATTGAGTGGTATCGCTCAGGCCCTCCCGGCGGCATGTCGTGGGTGCACCAGAGCTGGCGCATCTCGGAC
GACGAAGGAGGCATCTACGGCGAGGGCGCCAGCGTTTCCAGCTCCGGCATCAACTCGCGCAAGGCGAGCCCTCAC
TCGGACGCGCACGCGGCCATCGGCGACGTGATCGAATACCTGGACCTGGTTTCGCAAAAGGGCGACTCCAAGGCG
TCGTATAACCTCGGACGCATCTACTACGAAGGCCAACGGGGTCTCGAAAAGGACTTTGACCTGGCGCGACGGTAC
TTTTTCTTGGTGGCGTCTCGGTATTGGAAGAGGGACAGCCGGATCGTGGAGAACCACACCAAAGAGATTGAAAAG
ATGGCGGCCAAGGCGGCCGGCTTCATTGGGCGCATGTACCTCCGGGGCGACGGTGTGGTGCAGAATCCGGACCGG
GCCAAGGTCTGGTTCGACCGGGGCATCTCGCTGGGCGACGCGCAGTCGCAGTACGGGCGCGGCCTGATGCTACTC
AACGGGCTGGGCGGCAAGGAGAACGTCAAGCTGGCCATGGAGCTGTTTGCGGCCTCGGCCAACCAAGACTACGCG
CCGGCGCAGGTGCAGATGGGCCGTCTGTACCTAGACCAGGGAGGGCCGGACGACGTGCGCATCGCCAACAATCAC
TTTGAGCTCGCGGCGCGACACGGCAACATGGAGGCGCACCACTACCTGGCCGAGATGGTGTACAACGGCGTGGGC
AGGGAGAAGCTCTGCGGCGTGTCACTGAGTTACTACAAGACGGTGGCGGAGAAGGCGGAGCCGCTGGTATCGTCG
TGGGCAGACGCCAACGAGGCGTACGAGGCCGGCGACCTGGACCTCGCCCTCCTCGGCTACCTGATGGCGGCGGAG
CAGGGGTACGAAAAGGCGCAGACCAACGTGGCCTACATGCTGGACCCTCTGCGATCGCGGATGGCGGTGACGGGG
TGGAAGCGAAGGGCGACGGACGAGGGCAGCCTGCTCAACAACGCCGGGCTGGCCCTCATTTACTGGACGCGGTCG
TCGCGACAGTCCAACGTGGACGCGCTGGTCAAGATGGGAGACTACTACTTTTACGGCATCGGGACGGGGCGCGAC
GTGGGCAAGGCGGTGCAGTGCTACACGGGGGCGTCGGACTACTCCCAGAGCGCGCAGGCGCTCTATAACCTGGGC
TGGATGCACGAGAACGGGCTGGGGCTGACGCAGGACTTTCACCTGGCGAAGCGCTACTACGACCACGCGCTCGAG
GTCAACGAGGAGGCGTATCTACCGGTGACGCTGAGCCTGCTGAAGTTACGGGTGCGCAGCGCGTGGAACACGCTG
ACGCACGGGCCGATCCATTCGATCCAGGACGAGCCGAAGAAGGGCAAGGACTGGTCGCTGGCGGAGTGGATCGCC
AACTTTCTCGAGGACGACACGCTGTCGTACGAGGCCGAGGCGCGCGAGCAGGACAGCCTGGAGGGGGGCGGGATG
GGCGGCGGGAGGATGCGTCGCTGGAAGACGGGGGGTGCTGGAGAGCGTGCTGATTATCGGGGTGACGACGGCGCT
GCGGGGGGAGGCAACGATGAGGTCGACATCGGGGGCGACGGGAACGGCGGCCACGGCAACGGCCACGGCAACGGC
AACGGCAACGGCAACGGCAACGGCAACGGCAACGGCAACGGCGTCGACGGCTTCCGGGAGTGGGCGGCGGGAGGG
GCGATGCCGTGA
Gene >Ophcf2|03367
ATGAAGGTTCCGACCGTCTGGCTGCTCTGTGGGTTTCTGCTGCCCCCCCTCTCCCCTCCCCCCCTTCTCCTCCGC
GACTCGTCATCTAACGCGACGACCACTTGCAGTGCTTTGGCAGGCTGCCACGGTATTGGGCACCAACGCTCAGTA
CTATCGCGATACGCATACTGATAGAGCCGTTCGTCGTGAATCGAAAGACCATGGCCTCGGTACGAAAGCGGAGGC
CGCTGCCGACGATGAGGAACAGGCCCAGCCCATCATCCCGCAGCCAGGTCTGGTGTCCTGATCACTGCGTTTGAT
CCAGAGTTTTGTGCTGATGCTGAAGCGAAAACAGGTGCCGACCTCGTCAATGCCGCCATCGCCGAGCTCCGGACG
ATGCCGCGATCCGCGCACGCCCGGCGCCGACAGTCGTCGGGCCTCATTAGCTTTGCCTTTCGCTACATCATGAAG
ACGATCCCGACGAGGCCCGCTTCGGCGCCGACGCGGGAAAAGCAGGCTAAGCCCCCCGGCGGCGCCTCCCTCCAT
GCCGTTGAGCTACTTCAGCAGGCTGCCGATCAGAATAACTCGGATGCCCTGCTCATGCTGGCCGAGTTCAACTTT
TTCGGCAACCACAGCCACCCTCGAAACCTCGATGTCGCTTTTCGCAACTACAAGAAGCTGGCAGTCCATCACGGC
AACACGACGGCGCAGTACATGCTGGGCCTCTTCCACTCGACCGGCATCGGCGGTGTCGTCCCCCGCGACCAAGCC
AAGGCCCTCCTCTACTACACCTTCGCCGCCGCTAGAGGCGACACTCGTGCGGAGATGGCTACGGCCTTTCGGCAC
CACAATGGGATAGGCGCCGTCAAGGACTGCGAGACTGCCGTCAAGTACTATAAGCGAGTGGCCGACAAGGCCATT
GAGTGGTATCGCTCAGGCCCTCCCGGCGGCATGTCGTGGGTGCACCAGAGCTGGCGCATCTCGGACGACGAAGGA
GGCATCTACGGCGAGGGCGCCAGCGTTTCCAGCTCCGGCATCAACTCGCGCAAGGCGAGCCCTCACTCGGACGCG
CACGCGGCCATCGGCGACGTGATCGAATACCTGGACCTGGTTTCGCAAAAGGGCGACTCCAAGGCGTCGTATAAC
CTCGGACGCATCTACTACGAAGGCCAACGGGGTCTCGAAAAGGACTTTGACCTGGCGCGACGGTACTTTTTCTTG
GTGGCGTCTCGGTATTGGAAGAGGGACAGCCGGATCGTGGAGAACCACACCAAAGAGATTGAAAAGATGGCGGCC
AAGGCGGCCGGCTTCATTGGGCGCATGTACCTCCGGGGCGACGGTGTGGTGCAGAATCCGGACCGGGCCAAGGTC
TGGTTCGACCGGGGCATCTCGCTGGGCGACGCGCAGTCGCAGTACGGGCGCGGCCTGATGCTACTCAACGGGCTG
GGCGGCAAGGAGAACGTCAAGCTGGCCATGGAGCTGTTTGCGGCCTCGGCCAACCAAGACTACGCGCCGGCGCAG
GTGCAGATGGGCCGTCTGTACCTAGACCAGGGAGGGCCGGACGACGTGCGCATCGCCAACAATCACTTTGAGCTC
GCGGCGCGACACGGCAACATGGAGGCGCACCACTACCTGGCCGAGATGGTGTACAACGGCGTGGGCAGGGAGAAG
CTCTGCGGCGTGTCACTGAGTTACTACAAGACGGTGGCGGAGAAGGCGGAGCCGCTGGTATCGTCGTGGGCAGAC
GCCAACGAGGCGTACGAGGCCGGCGACCTGGACCTCGCCCTCCTCGGCTACCTGATGGCGGCGGAGCAGGGGTAC
GAAAAGGCGCAGACCAACGTGGCCTACATGCTGGACCCTCTGCGATCGCGGATGGCGGTGACGGGGTGGAAGCGA
AGGGCGACGGACGAGGGCAGCCTGCTCAACAACGCCGGGCTGGCCCTCATTTACTGGACGCGGTCGTCGCGACAG
TCCAACGTGGACGCGCTGGTCAAGATGGGAGACTACTACTTTTACGGCATCGGGACGGGGCGCGACGTGGGCAAG
GCGGTGCAGTGCTACACGGGGGCGTCGGACTACTCCCAGAGCGCGCAGGCGCTCTATAACCTGGGCTGGATGCAC
GAGAACGGGCTGGGGCTGACGCAGGACTTTCACCTGGCGAAGCGCTACTACGACCACGCGCTCGAGGTCAACGAG
GAGGCGTATCTACCGGTGACGCTGAGCCTGCTGAAGTTACGGGTGCGCAGCGCGTGGAACACGCTGACGCACGGG
CCGATCCATTCGATCCAGGACGAGCCGAGTAAGGCGACCGGTCACCCTCGATGGGCAGAACCCATGCTGACGACG
GGCGCAGAGAAGGGCAAGGACTGGTCGCTGGCGGAGTGGATCGCCAACTTTCTCGAGGACGACACGCTGTCGTAC
GAGGCCGAGGCGCGCGAGCAGGACAGCCTGGAGGGGGGCGGGATGGGCGGCGGGAGGATGCGTCGCTGGAAGACG
GGGGGTGCTGGAGAGCGTGCTGATTATCGGGGTGACGACGGCGCTGGTGCTGCTGCTCTGGTGGAGGCAGAGGAT
GCAGCAGGCGCACGGGCAGGCGGACGAGGAGCGACGGCGGAGGGGCATCAGCGGGGGGAGGCAACGATGAGGTCG
ACATCGGGGGCGACGGGAACGGCGGCCACGGCAACGGCCACGGCAACGGCAACGGCAACGGCAACGGCAACGGCA
ACGGCAACGGCAACGGCGTCGACGGCTTCCGGGAGTGGGCGGCGGGAGGGGCGATGCCGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail