Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03365
Gene name
Locationscaffold_03:2481828..2485210
Strand-
Gene length (bp)3382
Transcript length (bp)3072
Coding sequence length (bp)3072
Protein length (aa) 1024

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08101 Msb1-Mug8_dom Meiotically up-regulated protein Msb1/Mug8 domain 2.1E-165 44 509

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear localization signal 0.6993 0.2899 0.1628 0.4327 0.0933 0.02 0.1521 0.2261 0.3606 0.0207

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3085
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4200
Ophiocordyceps australis map64 (Brazil) OphauB2|4434
Ophiocordyceps camponoti-floridani Ophcf2|03365 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|7555
Ophiocordyceps kimflemingae Ophio5|2255
Ophiocordyceps subramaniannii Hirsu2|5359

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03365
MPGLFSRLKVRDGVKSKKKGATSDSSASQPLRQKWDDAYARKTVEPDEVHDLLHYCTAELKARGLDIPFLLLPFR
PTSNPSAVRTFIRHFFDHNYALRGELLLQELRMTEPMVISGVAKWCWSRLQGGIVGWDAYELFKVGEYDSNKARD
SFKTFIPISVDNGAKQRIIFDFFDLIAAIAAHGKSNGFGGRKLSRMAAWWAFEQRDTGSGFDGGYTAWLSAADAT
SHLFFAYLRSLSPEQNLTGISMLPRSLEKLLKETEYPPPPPKQLMSNTNKLAMVVDVVSPTPFALLRRAGHFEYR
ESDVGLQEFSNYEDPVKALTEECFRVLKAISAANQSQVSSVKHSTSLRDASWSRFEDIGFSCPLEEEEGDDDGTA
PARLQGIRSTPSSGVNQGRPTTPSWADFLSSGFNDENAARANMLLPPDKAIPPLESQMRQQQSSQSHRPRLEQEG
NLEPGELASINVIDLDDAFWWVWMSSLSPEETPERKSAFGRCAVIETKIRDARWIIVEELIIGAAPAPQAGAYIA
EKKRFFSWTKRGRTLTRHKSTLKKNRDRPEVEAAKGPVSKTMGAEAQAKIQAKAAQLRAKEEDEQKAAEEAASLN
RRGRTDAELISEKTNSIFTLQPNIVGEASSAMRWVNKYDKGAIKDAYLANSSAGRGVAVSPAPSDHADTPSSSNN
EAEPSTELMPVKESQSTTSLTSPLRSVHSRVQEQDLDESRVSSSVKASGSTVAPSLRESEDQPVSQPNKASSERS
KLHRHAHLQQPKEKSGGFRKLFSRKNRASKVPPNAASNLEAMRQQSSAAAPEVPQTPTPAATPPPAQESLAPAPP
SREAVTPPEESRAVPDGAPETPTSLEHPVNEPEVEYEEELVTEEVLSLIDTQDAAEASQEFSRFDQGPLADQPAV
KPEDEAPAAKTDDAAPPPMIRVPPRTGTPKAPEPEKAALDKLNQGASPGVQDRWAQIRKNAAQRAATRKEEPARV
VVRKSTDGEEDTSGEETIESRVARIKARVAELTSSAGTANGSQTVKAR*
Coding >Ophcf2|03365
ATGCCTGGCCTATTCTCCCGTCTCAAGGTCCGGGATGGCGTCAAGTCGAAGAAAAAGGGCGCCACCAGCGACTCG
TCCGCCTCCCAGCCGCTCAGGCAGAAATGGGACGATGCCTACGCTCGCAAGACGGTCGAGCCCGACGAGGTCCAC
GACCTGCTGCATTACTGCACTGCCGAGCTCAAGGCCCGAGGCCTCGATATCCCCTTCCTCCTTCTGCCATTTCGC
CCGACGTCGAACCCCAGCGCCGTCCGCACCTTCATCAGGCACTTTTTTGACCACAATTATGCCCTGAGAGGCGAG
CTGCTGCTCCAGGAGCTGCGCATGACGGAGCCCATGGTCATTTCAGGCGTGGCCAAGTGGTGCTGGAGCCGTCTC
CAGGGTGGCATCGTCGGCTGGGACGCCTACGAGCTCTTCAAGGTCGGTGAATACGATTCCAACAAGGCTCGCGAC
TCTTTCAAGACCTTTATCCCCATCAGCGTCGACAACGGCGCCAAGCAGCGCATCATCTTTGACTTCTTCGACCTC
ATCGCCGCCATCGCCGCCCATGGCAAGTCCAACGGCTTCGGCGGCCGGAAGCTGTCCCGCATGGCTGCCTGGTGG
GCCTTTGAGCAGAGAGACACGGGCAGCGGCTTCGACGGGGGCTACACGGCTTGGCTGAGCGCCGCCGATGCCACC
AGTCACTTGTTCTTCGCCTACCTGAGGTCCCTCTCGCCCGAGCAGAACCTGACGGGCATCTCCATGCTCCCCAGG
TCCCTCGAGAAGCTGCTCAAGGAGACGGAGTATCCGCCGCCGCCGCCCAAGCAGCTCATGTCCAACACCAACAAG
CTGGCCATGGTGGTCGACGTCGTTTCCCCGACCCCCTTCGCCCTCCTGAGGCGAGCCGGCCATTTCGAGTATCGC
GAGTCCGACGTGGGCCTCCAGGAGTTTTCAAACTACGAGGACCCCGTCAAGGCCTTGACCGAGGAGTGTTTCCGC
GTGCTCAAGGCCATCTCGGCCGCCAACCAGTCGCAAGTCTCGAGCGTTAAGCACTCTACCAGCCTGCGCGACGCC
TCGTGGTCTCGCTTCGAGGATATCGGCTTCTCGTGTCCCCTGGAGGAAGAGGAAGGCGATGACGATGGCACGGCC
CCTGCCAGGCTGCAGGGCATCCGGAGCACCCCTTCCTCGGGCGTCAATCAGGGTCGACCAACGACGCCTTCCTGG
GCCGACTTCTTGTCTTCGGGCTTCAACGACGAGAATGCGGCTCGGGCCAACATGCTCCTGCCCCCTGACAAGGCC
ATCCCGCCCCTCGAGAGCCAGATGAGACAGCAGCAGAGCTCGCAGTCGCACCGCCCGCGCCTCGAGCAGGAGGGC
AACCTCGAGCCCGGCGAGCTGGCCAGCATCAACGTCATCGACCTCGACGACGCCTTTTGGTGGGTGTGGATGAGC
AGCCTCTCGCCCGAGGAGACTCCGGAGAGGAAGTCGGCCTTTGGCAGGTGTGCCGTCATCGAGACCAAGATCAGG
GACGCCAGATGGATCATCGTCGAGGAGCTCATCATCGGCGCCGCTCCCGCACCCCAGGCCGGCGCGTACATCGCC
GAGAAGAAGCGCTTCTTCAGCTGGACCAAACGCGGACGCACCCTGACGCGACACAAGTCGACGCTCAAGAAGAAC
AGAGACCGACCCGAAGTCGAAGCGGCAAAGGGGCCCGTGAGCAAGACCATGGGCGCCGAGGCGCAGGCCAAGATT
CAGGCCAAAGCCGCCCAGCTCCGCGCCAAGGAGGAGGATGAGCAGAAGGCGGCCGAAGAGGCGGCGAGCCTTAAC
CGTCGCGGCCGCACCGACGCCGAGCTGATATCCGAAAAGACTAATAGTATCTTCACCCTTCAGCCCAACATCGTC
GGCGAGGCCTCGTCGGCCATGAGATGGGTCAACAAGTACGACAAGGGCGCTATTAAGGATGCGTACTTGGCCAAC
AGCAGCGCAGGCCGGGGCGTGGCCGTATCTCCCGCGCCTTCGGATCACGCCGACACGCCCTCTTCCAGCAACAAC
GAGGCAGAGCCGAGCACGGAGCTGATGCCCGTCAAGGAGTCGCAGTCGACCACGTCACTCACGTCTCCCCTGCGT
TCGGTCCACTCTCGCGTTCAGGAGCAGGATCTCGACGAGTCGCGCGTGTCGTCTTCGGTCAAGGCTTCGGGCTCG
ACCGTGGCCCCCTCATTGCGAGAGAGCGAGGATCAGCCCGTCTCTCAGCCCAACAAGGCCAGCTCCGAGAGGTCC
AAGCTGCACCGTCACGCGCACCTCCAGCAGCCGAAGGAGAAGTCGGGCGGCTTCCGGAAGCTGTTCAGCCGCAAG
AACCGAGCATCCAAGGTGCCCCCCAACGCTGCCAGCAACCTGGAGGCCATGCGGCAGCAGAGTTCCGCCGCGGCA
CCCGAGGTTCCGCAGACGCCGACGCCGGCCGCCACTCCGCCCCCGGCACAGGAGAGCCTTGCCCCCGCGCCGCCG
TCTCGGGAAGCCGTCACGCCGCCGGAGGAATCTCGTGCTGTTCCCGATGGAGCGCCGGAGACGCCCACGTCCCTG
GAGCATCCGGTGAACGAGCCCGAAGTCGAGTACGAGGAGGAGCTGGTGACGGAGGAGGTGCTTTCTCTCATTGAT
ACGCAAGACGCCGCCGAGGCGAGCCAGGAGTTCTCACGCTTCGACCAAGGGCCGCTGGCTGATCAGCCGGCCGTC
AAGCCCGAGGATGAAGCCCCGGCCGCAAAGACGGACGACGCCGCTCCGCCGCCCATGATCCGGGTCCCGCCCCGG
ACGGGAACGCCCAAGGCCCCGGAGCCCGAGAAGGCGGCCCTCGACAAGCTGAACCAAGGTGCCAGCCCCGGCGTG
CAGGATCGCTGGGCGCAGATCCGCAAGAATGCTGCGCAGAGGGCGGCCACGCGTAAGGAGGAGCCAGCCCGGGTC
GTGGTCCGCAAGTCGACGGACGGCGAGGAAGATACGAGCGGAGAGGAGACCATCGAGTCCCGCGTGGCTCGTATC
AAGGCACGCGTGGCCGAGCTCACGAGCAGCGCCGGTACCGCCAACGGATCCCAGACGGTCAAGGCGCGTTAG
Transcript >Ophcf2|03365
ATGCCTGGCCTATTCTCCCGTCTCAAGGTCCGGGATGGCGTCAAGTCGAAGAAAAAGGGCGCCACCAGCGACTCG
TCCGCCTCCCAGCCGCTCAGGCAGAAATGGGACGATGCCTACGCTCGCAAGACGGTCGAGCCCGACGAGGTCCAC
GACCTGCTGCATTACTGCACTGCCGAGCTCAAGGCCCGAGGCCTCGATATCCCCTTCCTCCTTCTGCCATTTCGC
CCGACGTCGAACCCCAGCGCCGTCCGCACCTTCATCAGGCACTTTTTTGACCACAATTATGCCCTGAGAGGCGAG
CTGCTGCTCCAGGAGCTGCGCATGACGGAGCCCATGGTCATTTCAGGCGTGGCCAAGTGGTGCTGGAGCCGTCTC
CAGGGTGGCATCGTCGGCTGGGACGCCTACGAGCTCTTCAAGGTCGGTGAATACGATTCCAACAAGGCTCGCGAC
TCTTTCAAGACCTTTATCCCCATCAGCGTCGACAACGGCGCCAAGCAGCGCATCATCTTTGACTTCTTCGACCTC
ATCGCCGCCATCGCCGCCCATGGCAAGTCCAACGGCTTCGGCGGCCGGAAGCTGTCCCGCATGGCTGCCTGGTGG
GCCTTTGAGCAGAGAGACACGGGCAGCGGCTTCGACGGGGGCTACACGGCTTGGCTGAGCGCCGCCGATGCCACC
AGTCACTTGTTCTTCGCCTACCTGAGGTCCCTCTCGCCCGAGCAGAACCTGACGGGCATCTCCATGCTCCCCAGG
TCCCTCGAGAAGCTGCTCAAGGAGACGGAGTATCCGCCGCCGCCGCCCAAGCAGCTCATGTCCAACACCAACAAG
CTGGCCATGGTGGTCGACGTCGTTTCCCCGACCCCCTTCGCCCTCCTGAGGCGAGCCGGCCATTTCGAGTATCGC
GAGTCCGACGTGGGCCTCCAGGAGTTTTCAAACTACGAGGACCCCGTCAAGGCCTTGACCGAGGAGTGTTTCCGC
GTGCTCAAGGCCATCTCGGCCGCCAACCAGTCGCAAGTCTCGAGCGTTAAGCACTCTACCAGCCTGCGCGACGCC
TCGTGGTCTCGCTTCGAGGATATCGGCTTCTCGTGTCCCCTGGAGGAAGAGGAAGGCGATGACGATGGCACGGCC
CCTGCCAGGCTGCAGGGCATCCGGAGCACCCCTTCCTCGGGCGTCAATCAGGGTCGACCAACGACGCCTTCCTGG
GCCGACTTCTTGTCTTCGGGCTTCAACGACGAGAATGCGGCTCGGGCCAACATGCTCCTGCCCCCTGACAAGGCC
ATCCCGCCCCTCGAGAGCCAGATGAGACAGCAGCAGAGCTCGCAGTCGCACCGCCCGCGCCTCGAGCAGGAGGGC
AACCTCGAGCCCGGCGAGCTGGCCAGCATCAACGTCATCGACCTCGACGACGCCTTTTGGTGGGTGTGGATGAGC
AGCCTCTCGCCCGAGGAGACTCCGGAGAGGAAGTCGGCCTTTGGCAGGTGTGCCGTCATCGAGACCAAGATCAGG
GACGCCAGATGGATCATCGTCGAGGAGCTCATCATCGGCGCCGCTCCCGCACCCCAGGCCGGCGCGTACATCGCC
GAGAAGAAGCGCTTCTTCAGCTGGACCAAACGCGGACGCACCCTGACGCGACACAAGTCGACGCTCAAGAAGAAC
AGAGACCGACCCGAAGTCGAAGCGGCAAAGGGGCCCGTGAGCAAGACCATGGGCGCCGAGGCGCAGGCCAAGATT
CAGGCCAAAGCCGCCCAGCTCCGCGCCAAGGAGGAGGATGAGCAGAAGGCGGCCGAAGAGGCGGCGAGCCTTAAC
CGTCGCGGCCGCACCGACGCCGAGCTGATATCCGAAAAGACTAATAGTATCTTCACCCTTCAGCCCAACATCGTC
GGCGAGGCCTCGTCGGCCATGAGATGGGTCAACAAGTACGACAAGGGCGCTATTAAGGATGCGTACTTGGCCAAC
AGCAGCGCAGGCCGGGGCGTGGCCGTATCTCCCGCGCCTTCGGATCACGCCGACACGCCCTCTTCCAGCAACAAC
GAGGCAGAGCCGAGCACGGAGCTGATGCCCGTCAAGGAGTCGCAGTCGACCACGTCACTCACGTCTCCCCTGCGT
TCGGTCCACTCTCGCGTTCAGGAGCAGGATCTCGACGAGTCGCGCGTGTCGTCTTCGGTCAAGGCTTCGGGCTCG
ACCGTGGCCCCCTCATTGCGAGAGAGCGAGGATCAGCCCGTCTCTCAGCCCAACAAGGCCAGCTCCGAGAGGTCC
AAGCTGCACCGTCACGCGCACCTCCAGCAGCCGAAGGAGAAGTCGGGCGGCTTCCGGAAGCTGTTCAGCCGCAAG
AACCGAGCATCCAAGGTGCCCCCCAACGCTGCCAGCAACCTGGAGGCCATGCGGCAGCAGAGTTCCGCCGCGGCA
CCCGAGGTTCCGCAGACGCCGACGCCGGCCGCCACTCCGCCCCCGGCACAGGAGAGCCTTGCCCCCGCGCCGCCG
TCTCGGGAAGCCGTCACGCCGCCGGAGGAATCTCGTGCTGTTCCCGATGGAGCGCCGGAGACGCCCACGTCCCTG
GAGCATCCGGTGAACGAGCCCGAAGTCGAGTACGAGGAGGAGCTGGTGACGGAGGAGGTGCTTTCTCTCATTGAT
ACGCAAGACGCCGCCGAGGCGAGCCAGGAGTTCTCACGCTTCGACCAAGGGCCGCTGGCTGATCAGCCGGCCGTC
AAGCCCGAGGATGAAGCCCCGGCCGCAAAGACGGACGACGCCGCTCCGCCGCCCATGATCCGGGTCCCGCCCCGG
ACGGGAACGCCCAAGGCCCCGGAGCCCGAGAAGGCGGCCCTCGACAAGCTGAACCAAGGTGCCAGCCCCGGCGTG
CAGGATCGCTGGGCGCAGATCCGCAAGAATGCTGCGCAGAGGGCGGCCACGCGTAAGGAGGAGCCAGCCCGGGTC
GTGGTCCGCAAGTCGACGGACGGCGAGGAAGATACGAGCGGAGAGGAGACCATCGAGTCCCGCGTGGCTCGTATC
AAGGCACGCGTGGCCGAGCTCACGAGCAGCGCCGGTACCGCCAACGGATCCCAGACGGTCAAGGCGCGTTAG
Gene >Ophcf2|03365
ATGCCTGGCCTATTCTCCCGTCTCAAGGTCCGGGATGGCGTCAAGTCGAAGAAAAAGGGCGCCACCAGCGACTCG
TCCGCCTCCCAGCCGCTCAGGCAGAAATGGGACGATGCCTACGCTCGCAAGACGGTCGAGCCCGACGAGGTCCAC
GACCTGCTGCATTACTGCACTGCCGAGCTCAAGGCCCGAGGTTCGTTTGCTTCTCGTACGAGACTCGCCCTTTTC
TGACGCTCGTCTTCTCCAGGCCTCGATATCCCCTTCCTCCTTCTGCCATTTCGCCCGACGTCGAACCCCAGCGCC
GTCCGCACCTTCATCAGGCACTTTTTTGACCACAATTATGCCCTGAGAGGCGAGCTGCTGCTCCAGGAGCTGCGC
ATGACGGAGCCCATGGTACGACGCCGCTCCGCCCTCCCGCCAACACTGTCGCTGACACGCCACGACTCAGGTCAT
TTCAGGCGTGGCCAAGTGGTGCTGGAGCCGTCTCCAGGGTGGCATCGTCGGCTGGGACGCCTACGAGCTCTTCAA
GGTCGGTGAATACGGTACGTCGCTGTCTCGCCCTCTTCCTGCTGCTGCTGCTGCTGCTGCTGCTGCTGCTGCTGG
TCCCCTTCGCTCACCGCGCGCGTCAAGATTCCAACAAGGCTCGCGACTCTTTCAAGACCTTTATCCCCATCAGCG
TCGACAACGGCGCCAAGCAGCGCATCATCTTTGACTTCTTCGACCTCATCGCCGCCATCGCCGCCCATGGCAAGT
CCAACGGCTTCGGCGGCCGGAAGCTGTCCCGCATGGCTGCCTGGTGGGCCTTTGAGCAGAGAGACACGGGCAGCG
GCTTCGACGGGGGCTACACGGCTTGGCTGAGGTCCGTCTTGAACCCGAGTCGCGATGCCCGAAGCTGACCAAGGA
GGGGACGTGCAGCGCCGCCGATGCCACCAGTCACTTGTTCTTCGCCTACCTGAGGTCCCTCTCGCCCGAGCAGAA
CCTGACGGGCATCTCCATGCTCCCCAGGTCCCTCGAGAAGCTGCTCAAGGAGACGGAGTATCCGCCGCCGCCGCC
CAAGCAGCTCATGTCCAACACCAACAAGCTGGCCATGGTGGTCGACGTCGTTTCCCCGACCCCCTTCGCCCTCCT
GAGGCGAGCCGGCCATTTCGAGTATCGCGAGTCCGACGTGGGCCTCCAGGAGTTTTCAAACTACGAGGACCCCGT
CAAGGCCTTGACCGAGGAGTGTTTCCGCGTGCTCAAGGCCATCTCGGCCGCCAACCAGTCGCAAGTCTCGAGCGT
TAAGCACTCTACCAGCCTGCGCGACGCCTCGTGGTCTCGCTTCGAGGATATCGGCTTCTCGTGTCCCCTGGAGGA
AGAGGAAGGCGATGACGATGGCACGGCCCCTGCCAGGCTGCAGGGCATCCGGAGCACCCCTTCCTCGGGCGTCAA
TCAGGGTCGACCAACGACGCCTTCCTGGGCCGACTTCTTGTCTTCGGGCTTCAACGACGAGAATGCGGCTCGGGC
CAACATGCTCCTGCCCCCTGACAAGGCCATCCCGCCCCTCGAGAGCCAGATGAGACAGCAGCAGAGCTCGCAGTC
GCACCGCCCGCGCCTCGAGCAGGAGGGCAACCTCGAGCCCGGCGAGCTGGCCAGCATCAACGTCATCGACCTCGA
CGACGCCTTTTGGTGGGTGTGGATGAGCAGCCTCTCGCCCGAGGAGACTCCGGAGAGGAAGTCGGCCTTTGGCAG
GTGTGCCGTCATCGAGACCAAGATCAGGGACGCCAGATGGATCATCGTCGAGGAGCTCATCATCGGCGCCGCTCC
CGCACCCCAGGCCGGCGCGTACATCGCCGAGAAGAAGCGCTTCTTCAGCTGGACCAAACGCGGACGCACCCTGAC
GCGACACAAGTCGACGCTCAAGAAGAACAGAGACCGACCCGAAGTCGAAGCGGCAAAGGGGCCCGTGAGCAAGAC
CATGGGCGCCGAGGCGCAGGCCAAGATTCAGGCCAAAGCCGCCCAGCTCCGCGCCAAGGAGGAGGATGAGCAGAA
GGCGGCCGAAGAGGCGGCGAGCCTTAACCGTCGCGGCCGCACCGACGCCGAGCTGATATCCGAAAAGACTAATAG
TATCTTCACCCTTCAGCCCAACATCGTCGGCGAGGCCTCGTCGGCCATGAGATGGGTCAACAAGTACGACAAGGG
CGCTATTAAGGATGCGTACTTGGCCAACAGCAGCGCAGGCCGGGGCGTGGCCGTATCTCCCGCGCCTTCGGATCA
CGCCGACACGCCCTCTTCCAGCAACAACGAGGCAGAGCCGAGCACGGAGCTGATGCCCGTCAAGGAGTCGCAGTC
GACCACGTCACTCACGTCTCCCCTGCGTTCGGTCCACTCTCGCGTTCAGGAGCAGGATCTCGACGAGTCGCGCGT
GTCGTCTTCGGTCAAGGCTTCGGGCTCGACCGTGGCCCCCTCATTGCGAGAGAGCGAGGATCAGCCCGTCTCTCA
GCCCAACAAGGCCAGCTCCGAGAGGTCCAAGCTGCACCGTCACGCGCACCTCCAGCAGCCGAAGGAGAAGTCGGG
CGGCTTCCGGAAGCTGTTCAGCCGCAAGAACCGAGCATCCAAGGTGCCCCCCAACGCTGCCAGCAACCTGGAGGC
CATGCGGCAGCAGAGTTCCGCCGCGGCACCCGAGGTTCCGCAGACGCCGACGCCGGCCGCCACTCCGCCCCCGGC
ACAGGAGAGCCTTGCCCCCGCGCCGCCGTCTCGGGAAGCCGTCACGCCGCCGGAGGAATCTCGTGCTGTTCCCGA
TGGAGCGCCGGAGACGCCCACGTCCCTGGAGCATCCGGTGAACGAGCCCGAAGTCGAGTACGAGGAGGAGCTGGT
GACGGAGGAGGTGCTTTCTCTCATTGATACGCAAGACGCCGCCGAGGCGAGCCAGGAGTTCTCACGCTTCGACCA
AGGGCCGCTGGCTGATCAGCCGGCCGTCAAGCCCGAGGATGAAGCCCCGGCCGCAAAGACGGACGACGCCGCTCC
GCCGCCCATGATCCGGGTCCCGCCCCGGACGGGAACGCCCAAGGCCCCGGAGCCCGAGAAGGCGGCCCTCGACAA
GCTGAACCAAGGTGCCAGCCCCGGCGTGCAGGATCGCTGGGCGCAGATCCGCAAGAATGCTGCGCAGAGGGCGGC
CACGCGTAAGGAGGAGCCAGCCCGGGTCGTGGTCCGCAAGTCGACGGACGGCGAGGAAGATACGAGCGGAGAGGA
GAGTGCGTAACGAAACCCATCCCCCCGATGACACGGCTGACTGACTGACGTCTTCCCAGCCATCGAGTCCCGCGT
GGCTCGTATCAAGGCACGCGTGGCCGAGCTCACGAGCAGCGCCGGTACCGCCAACGGATCCCAGACGGTCAAGGC
GCGTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail