Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03363
Gene name
Locationscaffold_03:2479619..2480134
Strand+
Gene length (bp)515
Transcript length (bp)447
Coding sequence length (bp)447
Protein length (aa) 149

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05277 DUF726 Protein of unknown function (DUF726) 5.0E-27 22 118

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Transmembrane domain 0.1582 0.1391 0.2185 0.3495 0.6585 0.1705 0.5028 0.2415 0.1956 0.1866

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 29 51 22
2 66 88 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 39.17 15.12 63.23
Alive In ants, during behavior modification 24.88 7.08 42.68
Dead In ants, recently dead 27.69 9.17 46.21

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.128067 no
Alive Dead 0.738573 no
Dead Fungus 0.226693 no

Orthologs

Orthofinder run ID4
Orthogroup11957
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|03363 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03363
MASTAEGMSAEAEAAKRRDENKASRYWKVGLASVAGAAVIGVTGGLAAPLVAGALGGILGGVGLGGVASFLGIFW
ANSALVGALFGAYGAKMTGEMMDSYAKEVEDFRFLPLNNNNNNNNNNNNQTSQEPPSQEPPTNQPQTKPTASA*
Coding >Ophcf2|03363
ATGGCATCCACCGCCGAGGGCATGTCCGCCGAAGCCGAGGCCGCCAAGCGCCGCGACGAGAACAAAGCCAGTCGG
TACTGGAAAGTCGGTCTCGCTTCCGTCGCGGGCGCTGCTGTCATCGGCGTCACGGGTGGGCTGGCGGCTCCGCTC
GTGGCCGGCGCGCTGGGAGGCATCTTGGGAGGCGTGGGACTGGGTGGCGTGGCGAGCTTCCTCGGCATCTTCTGG
GCCAATAGTGCGCTGGTCGGGGCTTTATTCGGGGCATACGGCGCAAAGATGACGGGCGAAATGATGGACAGCTAC
GCCAAAGAAGTCGAAGACTTCCGCTTCCTCCCCCTCAACAACAACAACAACAACAACAACAACAACAACAACCAA
ACCTCCCAAGAACCCCCATCCCAAGAACCCCCAACCAACCAACCCCAAACCAAGCCCACCGCCTCCGCCTAA
Transcript >Ophcf2|03363
ATGGCATCCACCGCCGAGGGCATGTCCGCCGAAGCCGAGGCCGCCAAGCGCCGCGACGAGAACAAAGCCAGTCGG
TACTGGAAAGTCGGTCTCGCTTCCGTCGCGGGCGCTGCTGTCATCGGCGTCACGGGTGGGCTGGCGGCTCCGCTC
GTGGCCGGCGCGCTGGGAGGCATCTTGGGAGGCGTGGGACTGGGTGGCGTGGCGAGCTTCCTCGGCATCTTCTGG
GCCAATAGTGCGCTGGTCGGGGCTTTATTCGGGGCATACGGCGCAAAGATGACGGGCGAAATGATGGACAGCTAC
GCCAAAGAAGTCGAAGACTTCCGCTTCCTCCCCCTCAACAACAACAACAACAACAACAACAACAACAACAACCAA
ACCTCCCAAGAACCCCCATCCCAAGAACCCCCAACCAACCAACCCCAAACCAAGCCCACCGCCTCCGCCTAA
Gene >Ophcf2|03363
ATGGCATCCACCGCCGAGGGCATGTCCGCCGAAGCCGAGGCCGCCAAGCGCCGCGACGAGAACAAAGCCAGTCGG
TACTGGAAAGTCGGTCTCGCTTCCGTCGCGGGCGCTGCTGTCATCGGCGTCACGGGTGGGCTGGCGGCTCCGCTC
GTGGCCGGCGCGCTGGGAGGCATCTTGGGAGGCGTGGGACTGGGTGGCGTGGCGAGCTTCCTCGGCATCTTCTGG
GCCAATAGTGCGCTGGTCGGGGCTTTATTCGGGGCATACGGCGCAAAGATGACGGTCAGTACGAACAAGCAACCT
TGTCTATCTTGGCCCAAACATCTCCTAACATGAGATGATGACCTCAGGGCGAAATGATGGACAGCTACGCCAAAG
AAGTCGAAGACTTCCGCTTCCTCCCCCTCAACAACAACAACAACAACAACAACAACAACAACAACCAAACCTCCC
AAGAACCCCCATCCCAAGAACCCCCAACCAACCAACCCCAAACCAAGCCCACCGCCTCCGCCTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail