Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03355
Gene name
Locationscaffold_03:2450721..2453029
Strand+
Gene length (bp)2308
Transcript length (bp)1860
Coding sequence length (bp)1860
Protein length (aa) 620

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 2.7E-29 115 396
PF07690 MFS_1 Major Facilitator Superfamily 1.6E-08 410 587
PF00083 Sugar_tr Sugar (and other) transporter 2.4E-08 146 259

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0016021 integral component of membrane Yes
GO:0005575 cellular_component No
GO:0051179 localization No
GO:0008150 biological_process No
GO:0031224 intrinsic component of membrane No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0003674 molecular_function No
GO:0005215 transporter activity No
GO:0110165 cellular anatomical entity No
GO:0051234 establishment of localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 52 0.45

Transmembrane Domains

Domain # Start End Length
1 177 196 19
2 201 223 22
3 235 257 22
4 279 301 22
5 370 387 17
6 424 446 22
7 458 476 18
8 486 508 22
9 515 537 22
10 552 574 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 80.46 45.23 115.69
Alive In ants, during behavior modification 47.78 22.58 72.98
Dead In ants, recently dead 40.89 22.53 59.25

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.012960 yes
Alive Dead 0.438593 no
Dead Fungus 0.000238 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03355
MPRHCVLPQQAGEGSLYEAIPSARARYDSHIGLAAFHRDIFLFKAPRPVCGWGILFNLVSRPRFGCFSHNAHDPI
AGFLDVPRCCQPAAPVAMTDSARSQPKLPVQQLVILVVARLAEPLAYTSIYPYLPEMISDFGIPQVDIARWAGLT
TAVFAVSQGLAAVPWGRASDRYGRKPVVLFGLASTMICFIVWGMSTSLTMAIIARAVQGAGSGNVAIIRTIVAEI
VPVKELQPRAFSIMPLVWSIGSVVGPAFGGFFAQPATKYPDWFGNIDFFHRFPYALPNLIASAFFLFSATTTFLF
LQESLSSKRGQHDVGLTLGHRLTHLFTRKSKPPRPSDAETPSDQEHPIPSQKLSAPEPPPGMKEAFTRQTVISLV
AYTFTSMHSVAFDQNVTVFLNYPVMEHTPENTQLPFFFNGGFGLKSDKIGIIFAIYGTTCGLIQFFLYPPLCRRF
GILKCWQFCSIAMPFIYIITPYASLFPTQQSRLTAVVLVLMLKGLVGIIAFPCITILFTNSCSSTRILGTVNGFA
TAFSGFARAIGPATTGFTFTWGVRHGCIAAAYYFLAIIAFIGAIPGFMVEEGDGPTRSEAESVEEAAADHQATAR
TRLVKGPFRATLDNLLNQC*
Coding >Ophcf2|03355
ATGCCGCGACACTGTGTTCTCCCGCAGCAGGCTGGTGAGGGGTCACTGTACGAGGCGATACCCTCGGCGCGCGCA
CGGTACGACAGCCACATCGGCCTGGCAGCCTTCCATCGGGACATTTTTTTGTTCAAGGCCCCAAGGCCCGTATGT
GGATGGGGCATTCTGTTCAATCTCGTCTCGCGTCCCCGGTTCGGCTGCTTCTCCCACAACGCGCACGATCCTATC
GCGGGATTCCTCGACGTCCCCCGCTGCTGTCAACCTGCTGCTCCCGTCGCAATGACGGACTCGGCGCGGTCGCAG
CCCAAGCTGCCCGTCCAACAACTCGTCATCCTAGTCGTCGCGCGGCTCGCTGAGCCACTGGCATACACCTCCATC
TACCCGTACCTCCCCGAGATGATCAGCGACTTTGGCATCCCACAGGTGGACATTGCCCGTTGGGCCGGCCTCACC
ACCGCCGTCTTCGCCGTCAGTCAGGGTCTGGCTGCCGTTCCGTGGGGTAGGGCTTCGGATCGGTATGGGAGGAAG
CCGGTCGTCCTGTTTGGTCTTGCCAGTACCATGATCTGCTTCATCGTCTGGGGCATGTCGACCAGCTTGACCATG
GCCATTATTGCGCGAGCCGTCCAGGGTGCTGGCAGTGGAAATGTCGCCATCATCAGGACCATCGTAGCCGAAATC
GTCCCCGTCAAGGAACTACAGCCCAGAGCCTTCTCCATCATGCCGCTGGTATGGTCTATCGGCTCCGTCGTCGGC
CCTGCATTCGGCGGTTTCTTCGCCCAGCCAGCAACCAAGTATCCAGACTGGTTCGGCAACATCGACTTCTTCCAT
CGCTTCCCCTACGCTCTCCCCAACCTCATCGCCAGCGCCTTCTTCCTCTTCTCCGCCACCACAACCTTTCTCTTC
CTCCAAGAATCCCTCTCATCCAAGCGCGGCCAACACGACGTGGGCCTCACTCTAGGCCACCGCCTCACCCACCTC
TTCACCCGAAAGTCCAAACCACCCCGTCCCTCAGACGCCGAGACCCCCTCGGATCAAGAGCATCCAATCCCCTCA
CAGAAGCTATCCGCGCCGGAACCCCCGCCAGGCATGAAGGAGGCCTTTACCCGACAGACGGTCATCAGCCTCGTA
GCCTACACCTTTACGTCGATGCACTCAGTCGCCTTTGACCAGAACGTCACCGTCTTTCTAAACTATCCCGTAATG
GAGCACACGCCCGAAAACACGCAGCTGCCCTTCTTCTTCAACGGCGGCTTCGGCCTCAAGTCGGATAAGATTGGC
ATCATCTTTGCCATCTACGGCACCACCTGCGGCCTCATCCAGTTCTTCCTTTACCCCCCCCTATGCAGACGCTTC
GGCATCTTGAAATGCTGGCAGTTTTGCTCCATCGCAATGCCCTTCATCTACATCATAACCCCCTACGCCTCCCTC
TTCCCCACGCAACAAAGCCGCCTCACAGCAGTGGTCCTAGTCCTAATGCTCAAAGGTCTGGTGGGCATAATCGCC
TTCCCCTGCATAACAATCCTCTTCACAAACTCGTGCTCCTCAACCCGCATCCTCGGCACGGTGAACGGCTTCGCC
ACCGCCTTCAGCGGCTTCGCCCGCGCCATCGGCCCCGCCACCACCGGCTTCACATTCACCTGGGGTGTGAGACAC
GGCTGCATCGCCGCGGCGTATTACTTCCTCGCCATCATTGCTTTCATCGGCGCCATTCCCGGGTTCATGGTCGAG
GAGGGGGATGGTCCGACGAGGTCCGAGGCTGAGTCGGTTGAGGAAGCCGCTGCGGATCACCAAGCTACGGCGCGC
ACCAGGCTCGTCAAAGGACCGTTCAGGGCGACGCTCGACAACCTTCTTAACCAATGTTAA
Transcript >Ophcf2|03355
ATGCCGCGACACTGTGTTCTCCCGCAGCAGGCTGGTGAGGGGTCACTGTACGAGGCGATACCCTCGGCGCGCGCA
CGGTACGACAGCCACATCGGCCTGGCAGCCTTCCATCGGGACATTTTTTTGTTCAAGGCCCCAAGGCCCGTATGT
GGATGGGGCATTCTGTTCAATCTCGTCTCGCGTCCCCGGTTCGGCTGCTTCTCCCACAACGCGCACGATCCTATC
GCGGGATTCCTCGACGTCCCCCGCTGCTGTCAACCTGCTGCTCCCGTCGCAATGACGGACTCGGCGCGGTCGCAG
CCCAAGCTGCCCGTCCAACAACTCGTCATCCTAGTCGTCGCGCGGCTCGCTGAGCCACTGGCATACACCTCCATC
TACCCGTACCTCCCCGAGATGATCAGCGACTTTGGCATCCCACAGGTGGACATTGCCCGTTGGGCCGGCCTCACC
ACCGCCGTCTTCGCCGTCAGTCAGGGTCTGGCTGCCGTTCCGTGGGGTAGGGCTTCGGATCGGTATGGGAGGAAG
CCGGTCGTCCTGTTTGGTCTTGCCAGTACCATGATCTGCTTCATCGTCTGGGGCATGTCGACCAGCTTGACCATG
GCCATTATTGCGCGAGCCGTCCAGGGTGCTGGCAGTGGAAATGTCGCCATCATCAGGACCATCGTAGCCGAAATC
GTCCCCGTCAAGGAACTACAGCCCAGAGCCTTCTCCATCATGCCGCTGGTATGGTCTATCGGCTCCGTCGTCGGC
CCTGCATTCGGCGGTTTCTTCGCCCAGCCAGCAACCAAGTATCCAGACTGGTTCGGCAACATCGACTTCTTCCAT
CGCTTCCCCTACGCTCTCCCCAACCTCATCGCCAGCGCCTTCTTCCTCTTCTCCGCCACCACAACCTTTCTCTTC
CTCCAAGAATCCCTCTCATCCAAGCGCGGCCAACACGACGTGGGCCTCACTCTAGGCCACCGCCTCACCCACCTC
TTCACCCGAAAGTCCAAACCACCCCGTCCCTCAGACGCCGAGACCCCCTCGGATCAAGAGCATCCAATCCCCTCA
CAGAAGCTATCCGCGCCGGAACCCCCGCCAGGCATGAAGGAGGCCTTTACCCGACAGACGGTCATCAGCCTCGTA
GCCTACACCTTTACGTCGATGCACTCAGTCGCCTTTGACCAGAACGTCACCGTCTTTCTAAACTATCCCGTAATG
GAGCACACGCCCGAAAACACGCAGCTGCCCTTCTTCTTCAACGGCGGCTTCGGCCTCAAGTCGGATAAGATTGGC
ATCATCTTTGCCATCTACGGCACCACCTGCGGCCTCATCCAGTTCTTCCTTTACCCCCCCCTATGCAGACGCTTC
GGCATCTTGAAATGCTGGCAGTTTTGCTCCATCGCAATGCCCTTCATCTACATCATAACCCCCTACGCCTCCCTC
TTCCCCACGCAACAAAGCCGCCTCACAGCAGTGGTCCTAGTCCTAATGCTCAAAGGTCTGGTGGGCATAATCGCC
TTCCCCTGCATAACAATCCTCTTCACAAACTCGTGCTCCTCAACCCGCATCCTCGGCACGGTGAACGGCTTCGCC
ACCGCCTTCAGCGGCTTCGCCCGCGCCATCGGCCCCGCCACCACCGGCTTCACATTCACCTGGGGTGTGAGACAC
GGCTGCATCGCCGCGGCGTATTACTTCCTCGCCATCATTGCTTTCATCGGCGCCATTCCCGGGTTCATGGTCGAG
GAGGGGGATGGTCCGACGAGGTCCGAGGCTGAGTCGGTTGAGGAAGCCGCTGCGGATCACCAAGCTACGGCGCGC
ACCAGGCTCGTCAAAGGACCGTTCAGGGCGACGCTCGACAACCTTCTTAACCAATGTTAA
Gene >Ophcf2|03355
ATGCCGCGACACTGTGTTCTCCCGCAGCAGGCTGGTGAGGGGTCACTGTACGAGGCGATACCCTCGGCGCGCGCA
CGGTACGACAGCCACATCGGCCTGGCAGCCTTCCATCGGGACATTTTTTTGTTCAAGGCCCCAAGGCCCGTATGT
GGATGGGGCATTGTGCGTCATGGGCCTATTTTCTGACTCGATTGCTGCGATCTTGCTTGGTAATTTACGCTGACC
GCCTCCGGTGTCGCTCATGGCAGCTGTTCAATCTCGTCTCGCGTCCCCGGTTCGGCTGCTTCTCCCACAACGCGC
ACGATCCTATCGCGGGATTCCTCGACGTCCCCCGCTGCTGTCAACCTGCTGCTGTCAACCTGCTGCTGTCAACCT
GCTGCTGATCCCTCACTGACACTCACCTCGTCAGCCCGTCGCAATGACGGACTCGGCGCGGTCGCAGCCCAAGCT
GCCCGTCCAACAACTCGTCATCCTAGGTCCGTCCCCCCCCCCCCCCCCAAAACAACCATCAAGCAAACTCCTCCC
CCCAATCCTAACCCTAACGTCTTCATCCCACAGTCGTCGCGCGGCTCGCTGAGCCACTGGCATACACCTCCATCT
ACCCGTACCTCCCCGAGATGATCAGCGACTTTGGCATCCCACAGGTGGACATTGCCCGTTGGGCCGGCCTCACCA
CCGCCGTCTTCGCCGTCAGTCAGGGTCTGGCTGCCGTTCCGTGGGGTAGGGCTTCGGATCGGTATGGGAGGAAGC
CGGTCGTCCTGTTTGGTCTTGCCAGTACCATGATCTGCTTCATCGTCTGGGGCATGTCGACCAGCTTGACCATGG
CCATTATTGCGCGAGCCGTCCAGGGTGCTGGCAGTGGAAATGGTAACCTCACCTCTCTATCTTCTTTTTTTTACA
TCAAAATGATCTCTACTGACGATAACCCAGTCGCCATCATCAGGACCATCGTAGCCGAAATCGTCCCCGTCAAGG
AACTACAGCCCAGAGCCTTCTCCATCATGCCGCTGGTATGGTCTATCGGCTCCGTCGTCGGCCCTGCATTCGGCG
GTTTCTTCGCCCAGCCAGCAACCAAGTATCCAGACTGGTTCGGCAACATCGACTTCTTCCATCGCTTCCCCTACG
CTCTCCCCAACCTCATCGCCAGCGCCTTCTTCCTCTTCTCCGCCACCACAACCTTTCTCTTCCTCCAAGTACCTA
CGTCATCTTCCCCCCCCTCATAAGCCCCTCGACAGCTAACACGCAAAAGGAATCCCTCTCATCCAAGCGCGGCCA
ACACGACGTGGGCCTCACTCTAGGCCACCGCCTCACCCACCTCTTCACCCGAAAGTCCAAACCACCCCGTCCCTC
AGACGCCGAGACCCCCTCGGATCAAGAGCATCCAATCCCCTCACAGAAGCTATCCGCGCCGGAACCCCCGCCAGG
CATGAAGGAGGCCTTTACCCGACAGACGGTCATCAGCCTCGTAGCCTACACCTTTACGTCGATGCACTCAGTCGC
CTTTGACCAGAACGTCACCGTCTTTCTAAACTATCCCGTAATGGAGCACACGCCCGAAAACACGCAGCTGCCCTT
CTTCTTCAACGGCGGCTTCGGCCTCAAGTCGGATAAGATTGGCATCATCTTTGCCATCTACGGCACCACCTGCGG
CCTCATCCAGTTCTTCCTTTACCCCCCCCTATGCAGACGCTTCGGCATCTTGAAATGCTGGCAGTTTTGCTGTAC
GTCTCCCCCCTCTTCATCTGAAAACAAGTCCCGGCTGACACGACGAAATCAGCCATCGCAATGCCCTTCATCTAC
ATCATAACCCCCTACGCCTCCCTCTTCCCCACGCAACAAAGCCGCCTCACAGCAGTGGTCCTAGTCCTAATGCTC
AAAGGTCTGGTGGGCATAATCGCCTTCCCCTGCATAACAATCCTCTTCACAAACTCGTGCTCCTCAACCCGCATC
CTCGGCACGGTGAACGGCTTCGCCACCGCCTTCAGCGGCTTCGCCCGCGCCATCGGCCCCGCCACCACCGGCTTC
ACATTCACCTGGGGTGTGAGACACGGCTGCATCGCCGCGGCGTATTACTTCCTCGCCATCATTGCTTTCATCGGC
GCCATTCCCGGGTTCATGGTCGAGGAGGGGGATGGTCCGACGAGGTCCGAGGCTGAGTCGGTTGAGGAAGCCGCT
GCGGATCACCAAGGTGAAAGGAGTGGCGAGAATACCCCCTTGCTGACGGATGCATCTCGAAGCTACGGCGCGCAC
CAGGCTCGTCAAAGGACCGTTCAGGGCGACGCTCGACAACCTTCTTAACCAATGTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail