Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03354
Gene name
Locationscaffold_03:2447585..2450107
Strand-
Gene length (bp)2522
Transcript length (bp)2340
Coding sequence length (bp)2340
Protein length (aa) 780

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04253 TFR_dimer Transferrin receptor-like dimerisation domain 6.7E-24 654 774
PF04389 Peptidase_M28 Peptidase family M28 2.3E-19 388 574
PF02225 PA PA domain 3.0E-05 195 266

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 32 0.5

Transmembrane Domains

Domain # Start End Length
1 31 53 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03354
MVRQSESTPLIQTVQIGPPPRRYPHQTCRRFCTIACASLLTTGFLYFMIHAFFVWPHHHRHDPQSRYALAGRESL
SHERLKSILLDTPSAEKAKEWSRYYTSGPHLAGKNYSQAEWTMDKWLGWGVQAGIASYDTYINYPVDHDLALLNR
SDKSGSWEVAFKASLEEDVLEDDPTTALDTRIPTFHGYSASGNATASFVYVNYGTHRDFEDLVEADVVLRGHIAV
ARYGGVFRGLIVKRAQELGMLAVVIYSDPGDDGEMTVENGHEAYPKGPARNPSSVQRGSVQFLSIRPGDPSTPGY
PSKPGVPRAPVDDAIPSIPSLPISYADALPILKALNGHGPKAADLGPRWRANVGLGYKGVEYNVGPSPSNLKLKL
SNEQEYTITPLWNVIGVVNGSVPHQVLVVGNHRDAWIAGGAADPNSGSAVLNELVRGVGKAVEAGWKPLRTIVFA
SWDGEEYGLIGSTEWVEEYLPWLSEANVAYLNVDIGAAGPELRASAAPLLHQILRDATRAVPSPNQTIEGQTLGD
VWNGHISTIGSGSDFTAFQDFAGIPCIDVSFKDGRDSPVYHYHSNYDSFHWMETYGDPGFRYHVAMARLLGILVA
ELSNSIVLPFRAADYADALASYLSKVLDKLHAPLPNPSTNKPANGTATALEAALETLAHSLSELRLRSARLDGRA
AWANARLEEGTPWWDVIGKIRLWITIANVNAQYKFLERTFLFEGGLDGRAWFKHVVFAPGLWTGYAGAVFPGLME
SIDARDYNNGLKWAAIIDRCVWRAIRCVE*
Coding >Ophcf2|03354
ATGGTCCGTCAGTCCGAGTCTACGCCTCTGATCCAGACGGTTCAGATCGGTCCTCCGCCGAGGCGATATCCGCAT
CAGACATGTCGGCGCTTCTGCACCATTGCCTGCGCCTCGCTTCTTACTACCGGCTTCTTGTACTTTATGATTCAT
GCTTTCTTCGTTTGGCCTCATCATCACCGTCATGACCCGCAGAGTCGGTACGCTCTTGCTGGAAGGGAGTCTCTT
AGCCATGAGCGGCTCAAGTCGATATTGCTCGATACTCCTTCGGCGGAAAAGGCAAAGGAATGGAGTCGTTATTAC
ACGTCTGGGCCTCATCTCGCTGGCAAGAACTATTCCCAGGCGGAGTGGACCATGGACAAGTGGTTGGGCTGGGGC
GTCCAGGCTGGCATCGCGTCTTACGACACTTACATCAACTACCCCGTCGACCACGACCTAGCCCTGCTGAATCGC
AGCGACAAGTCCGGCTCTTGGGAGGTAGCCTTCAAGGCTTCGCTGGAGGAGGACGTCCTCGAGGACGATCCGACG
ACTGCTCTCGACACCAGGATCCCCACCTTTCACGGCTACTCTGCCAGCGGAAACGCCACGGCCTCGTTCGTCTAC
GTCAATTACGGCACGCACCGAGACTTTGAGGACCTTGTCGAGGCCGACGTCGTGCTTCGGGGTCATATCGCCGTC
GCTCGTTATGGCGGTGTCTTCCGCGGTCTGATTGTTAAGCGCGCGCAGGAGCTTGGCATGTTGGCTGTCGTTATA
TACAGCGATCCGGGCGATGATGGTGAAATGACGGTTGAGAATGGACACGAGGCTTATCCTAAAGGCCCGGCGCGC
AACCCTTCCAGTGTGCAGCGTGGGAGCGTGCAGTTCCTCAGCATTCGGCCGGGAGATCCATCTACGCCCGGATAT
CCCTCCAAGCCGGGCGTTCCCCGTGCCCCAGTCGACGACGCCATACCGTCCATCCCCTCACTCCCCATCTCCTAC
GCCGACGCCCTCCCCATTCTCAAAGCCCTCAACGGCCATGGACCTAAAGCCGCCGACCTCGGTCCCCGCTGGAGA
GCAAACGTCGGTCTCGGCTACAAAGGCGTCGAGTACAATGTCGGCCCATCGCCGAGCAACTTGAAGCTCAAGCTC
TCAAACGAGCAGGAATACACAATCACACCTCTATGGAACGTCATCGGCGTCGTCAACGGGTCCGTGCCACACCAG
GTTCTCGTCGTCGGCAACCACCGGGATGCGTGGATCGCGGGCGGAGCTGCAGATCCCAATAGCGGCTCTGCCGTT
CTCAACGAGCTGGTTCGCGGCGTGGGGAAGGCCGTGGAGGCTGGTTGGAAGCCGCTGCGGACCATTGTCTTCGCC
AGCTGGGATGGTGAAGAGTATGGACTCATCGGGAGCACCGAGTGGGTTGAGGAGTATCTCCCCTGGCTCTCTGAA
GCCAACGTCGCCTACCTCAACGTCGACATTGGCGCAGCGGGACCCGAACTGAGAGCTTCAGCCGCGCCGCTTCTT
CACCAGATCCTTCGCGACGCGACGCGAGCGGTGCCATCTCCCAACCAGACCATCGAGGGACAGACACTGGGCGAC
GTCTGGAACGGCCACATCAGCACCATAGGCAGCGGTAGCGACTTCACCGCCTTCCAGGACTTCGCAGGCATCCCC
TGCATCGACGTCTCCTTCAAGGACGGCCGAGACTCGCCCGTATATCACTACCACAGCAACTACGACAGCTTCCAC
TGGATGGAAACGTACGGCGACCCTGGTTTCCGCTACCACGTCGCCATGGCCCGTCTGCTAGGCATCCTAGTAGCA
GAGCTGAGCAACAGCATCGTCCTCCCCTTCAGAGCAGCCGATTACGCCGACGCCCTCGCAAGCTACCTCAGCAAA
GTCCTCGACAAACTCCACGCCCCCCTCCCCAACCCATCAACCAACAAGCCGGCAAACGGCACCGCCACCGCCCTC
GAAGCCGCCCTCGAAACCCTCGCCCACTCCCTCTCCGAGCTCCGCCTCCGCTCGGCACGCCTCGACGGGAGAGCC
GCATGGGCCAACGCCCGGCTGGAAGAGGGGACGCCCTGGTGGGACGTCATCGGCAAGATCCGCCTCTGGATCACC
ATCGCCAATGTCAACGCGCAGTACAAGTTCTTGGAGCGGACCTTTTTGTTCGAGGGCGGGTTGGATGGGCGGGCT
TGGTTCAAGCATGTTGTTTTCGCGCCTGGGCTTTGGACCGGCTACGCTGGAGCTGTTTTTCCAGGGCTGATGGAG
AGCATCGATGCGAGGGATTATAATAATGGGTTGAAGTGGGCTGCCATCATCGACCGGTGTGTCTGGCGCGCGATC
CGCTGTGTCGAGTGA
Transcript >Ophcf2|03354
ATGGTCCGTCAGTCCGAGTCTACGCCTCTGATCCAGACGGTTCAGATCGGTCCTCCGCCGAGGCGATATCCGCAT
CAGACATGTCGGCGCTTCTGCACCATTGCCTGCGCCTCGCTTCTTACTACCGGCTTCTTGTACTTTATGATTCAT
GCTTTCTTCGTTTGGCCTCATCATCACCGTCATGACCCGCAGAGTCGGTACGCTCTTGCTGGAAGGGAGTCTCTT
AGCCATGAGCGGCTCAAGTCGATATTGCTCGATACTCCTTCGGCGGAAAAGGCAAAGGAATGGAGTCGTTATTAC
ACGTCTGGGCCTCATCTCGCTGGCAAGAACTATTCCCAGGCGGAGTGGACCATGGACAAGTGGTTGGGCTGGGGC
GTCCAGGCTGGCATCGCGTCTTACGACACTTACATCAACTACCCCGTCGACCACGACCTAGCCCTGCTGAATCGC
AGCGACAAGTCCGGCTCTTGGGAGGTAGCCTTCAAGGCTTCGCTGGAGGAGGACGTCCTCGAGGACGATCCGACG
ACTGCTCTCGACACCAGGATCCCCACCTTTCACGGCTACTCTGCCAGCGGAAACGCCACGGCCTCGTTCGTCTAC
GTCAATTACGGCACGCACCGAGACTTTGAGGACCTTGTCGAGGCCGACGTCGTGCTTCGGGGTCATATCGCCGTC
GCTCGTTATGGCGGTGTCTTCCGCGGTCTGATTGTTAAGCGCGCGCAGGAGCTTGGCATGTTGGCTGTCGTTATA
TACAGCGATCCGGGCGATGATGGTGAAATGACGGTTGAGAATGGACACGAGGCTTATCCTAAAGGCCCGGCGCGC
AACCCTTCCAGTGTGCAGCGTGGGAGCGTGCAGTTCCTCAGCATTCGGCCGGGAGATCCATCTACGCCCGGATAT
CCCTCCAAGCCGGGCGTTCCCCGTGCCCCAGTCGACGACGCCATACCGTCCATCCCCTCACTCCCCATCTCCTAC
GCCGACGCCCTCCCCATTCTCAAAGCCCTCAACGGCCATGGACCTAAAGCCGCCGACCTCGGTCCCCGCTGGAGA
GCAAACGTCGGTCTCGGCTACAAAGGCGTCGAGTACAATGTCGGCCCATCGCCGAGCAACTTGAAGCTCAAGCTC
TCAAACGAGCAGGAATACACAATCACACCTCTATGGAACGTCATCGGCGTCGTCAACGGGTCCGTGCCACACCAG
GTTCTCGTCGTCGGCAACCACCGGGATGCGTGGATCGCGGGCGGAGCTGCAGATCCCAATAGCGGCTCTGCCGTT
CTCAACGAGCTGGTTCGCGGCGTGGGGAAGGCCGTGGAGGCTGGTTGGAAGCCGCTGCGGACCATTGTCTTCGCC
AGCTGGGATGGTGAAGAGTATGGACTCATCGGGAGCACCGAGTGGGTTGAGGAGTATCTCCCCTGGCTCTCTGAA
GCCAACGTCGCCTACCTCAACGTCGACATTGGCGCAGCGGGACCCGAACTGAGAGCTTCAGCCGCGCCGCTTCTT
CACCAGATCCTTCGCGACGCGACGCGAGCGGTGCCATCTCCCAACCAGACCATCGAGGGACAGACACTGGGCGAC
GTCTGGAACGGCCACATCAGCACCATAGGCAGCGGTAGCGACTTCACCGCCTTCCAGGACTTCGCAGGCATCCCC
TGCATCGACGTCTCCTTCAAGGACGGCCGAGACTCGCCCGTATATCACTACCACAGCAACTACGACAGCTTCCAC
TGGATGGAAACGTACGGCGACCCTGGTTTCCGCTACCACGTCGCCATGGCCCGTCTGCTAGGCATCCTAGTAGCA
GAGCTGAGCAACAGCATCGTCCTCCCCTTCAGAGCAGCCGATTACGCCGACGCCCTCGCAAGCTACCTCAGCAAA
GTCCTCGACAAACTCCACGCCCCCCTCCCCAACCCATCAACCAACAAGCCGGCAAACGGCACCGCCACCGCCCTC
GAAGCCGCCCTCGAAACCCTCGCCCACTCCCTCTCCGAGCTCCGCCTCCGCTCGGCACGCCTCGACGGGAGAGCC
GCATGGGCCAACGCCCGGCTGGAAGAGGGGACGCCCTGGTGGGACGTCATCGGCAAGATCCGCCTCTGGATCACC
ATCGCCAATGTCAACGCGCAGTACAAGTTCTTGGAGCGGACCTTTTTGTTCGAGGGCGGGTTGGATGGGCGGGCT
TGGTTCAAGCATGTTGTTTTCGCGCCTGGGCTTTGGACCGGCTACGCTGGAGCTGTTTTTCCAGGGCTGATGGAG
AGCATCGATGCGAGGGATTATAATAATGGGTTGAAGTGGGCTGCCATCATCGACCGGTGTGTCTGGCGCGCGATC
CGCTGTGTCGAGTGA
Gene >Ophcf2|03354
ATGGTCCGTCAGTCCGAGTCTACGCCTCTGATCCAGACGGTTCAGATCGGTCCTCCGCCGAGGCGATATCCGCAT
CAGACATGTCGGCGCTTCTGCACCATTGCCTGCGCCTCGCTTCTTACTACCGGCTTCTTGTACTTTATGATTCAT
GCTTTCTTCGTTTGGCCTCATCATCACCGTCATGACCCGCAGAGTCGGTACGCTCTTGCTGGAAGGGAGTCTCTT
AGCCATGAGCGGCTCAAGTCGATATTGCTCGATACTCCTTCGGCGGAAAAGGCAAAGGAATGGAGTCGTTATTAC
ACGTCTGGGCCTCATCTCGCTGGCAAGAACTATTCCCAGGTATGACATCTCTCTCCACCAACCAGACTACCGCTG
ACAGTCGCAGGCGGAGTGGACCATGGACAAGTGGTTGGGCTGGGGCGTCCAGGCTGGCATCGCGTCTTACGACAC
TTACATCAACTACCCCGTCGACCACGACCTAGCCCTGCTGAATCGCAGCGACAAGTCCGGCTCTTGGGAGGTAGC
CTTCAAGGCTTCGCTGGAGGAGGACGTCCTCGAGGACGATCCGACGACTGCTCTCGACACCAGGATCCCCACCTT
TCACGGCTACTCTGCCAGCGGAAACGCCACGGCCTCGTTCGTCTACGTCAATTACGGCACGCACCGAGACTTTGA
GGACCTTGTCGAGGCCGACGTCGTGCTTCGGGGTCATATCGCCGTCGCTCGTTATGGCGGTGTCTTCCGCGGTCT
GATTGTTAAGCGCGCGCAGGAGCTTGGCATGTTGGCTGTCGTTATATACAGCGATCCGGGCGATGATGGTGAAAT
GACGGTTGAGAATGGACACGAGGCTTATCCTAAAGGCCCGGCGCGCAACCCTTCCAGTGTGCAGCGTGGGAGCGT
GCAGTTCCTCAGCATTCGGCCGGGAGATCCGTGCGTTTCCCGTCCGCGTTGCGAGGCAGTTGGATAGCCGTGGGG
AGTGACTGACACGTCGAGACTGCAGATCTACGCCCGGATATCCCTCCAAGCCGGGCGTTCCCCGTGCCCCAGTCG
ACGACGCCATACCGTCCATCCCCTCACTCCCCATCTCCTACGCCGACGCCCTCCCCATTCTCAAAGCCCTCAACG
GCCATGGACCTAAAGCCGCCGACCTCGGTCCCCGCTGGAGAGCAAACGTCGGTCTCGGCTACAAAGGCGTCGAGT
ACAATGTCGGCCCATCGCCGAGCAACTTGAAGCTCAAGCTCTCAAACGAGCAGGAATACACAATCACACCTCTAT
GGAACGTCATCGGCGTCGTCAACGGGTCCGTGCCACACCAGGTTCTCGTCGTCGGCAACCACCGGGATGCGTGGA
TCGCGGGCGGAGCTGCAGATCCCAATAGCGGCTCTGCCGTTCTCAACGAGCTGGTTCGCGGCGTGGGGAAGGCCG
TGGAGGCTGGTTGGAAGCCGCTGCGGACCATTGTCTTCGCCAGCTGGGATGGTGAAGAGTATGGACTCATCGGGA
GCACCGAGTGGGTTGAGGAGTATCTCCCCTGGCTCTCTGAAGCCAACGTCGCCTACCTCAACGTCGACATTGGCG
CAGCGGGACCCGAACTGAGAGCTTCAGCCGCGCCGCTTCTTCACCAGATCCTTCGCGACGCGACGCGAGCGGTGC
CATCTCCCAACCAGACCATCGAGGGACAGACACTGGGCGACGTCTGGAACGGCCACATCAGCACCATAGGCAGCG
GTAGCGACTTCACCGCCTTCCAGGACTTCGCAGGCATCCCCTGCATCGACGTCTCCTTCAAGGACGGCCGAGACT
CGCCCGTATATCACTACCACAGCAACTACGACAGCTTCCACTGGATGGAAACGTACGGCGACCCTGGTTTCCGCT
ACCACGTCGCCATGGCCCGTCTGCTAGGCATCCTAGTAGCAGAGCTGAGCAACAGCATCGTCCTCCCCTTCAGAG
CAGCCGATTACGCCGACGCCCTCGCAAGCTACCTCAGCAAAGTCCTCGACAAACTCCACGCCCCCCTCCCCAACC
CATCAACCAACAAGCCGGCAAACGGCACCGCCACCGCCCTCGAAGCCGCCCTCGAAACCCTCGCCCACTCCCTCT
CCGAGCTCCGCCTCCGCTCGGCACGCCTCGACGGGAGAGCCGCATGGGCCAACGCCCGGCTGGAAGAGGGGACGC
CCTGGTGGGACGTCATCGGCAAGATCCGCCTCTGGATCACCATCGCCAATGTCAACGCGCAGTACAAGTTCTTGG
AGCGGACCTTTTTGTTCGAGGGCGGGTTGGATGGGCGGGCTTGGTTCAAGCATGTTGTTTTCGCGCCTGGGCTTT
GGACCGGCTACGCTGGAGGTTTGTTTCCCGCTTCCCCCCTTTCCTTTTGCTTGAGAAGAGTGGTGATGCTGATGG
GTTGGATAGCTGTTTTTCCAGGGCTGATGGAGAGCATCGATGCGAGGGATTATAATAATGGGTTGAAGTGGGCTG
CCATCATCGACCGGTGTGTCTGGCGCGCGATCCGCTGTGTCGAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail