Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03353
Gene name
Locationscaffold_03:2446082..2447293
Strand+
Gene length (bp)1211
Transcript length (bp)1071
Coding sequence length (bp)1071
Protein length (aa) 357

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain 2.6E-30 216 327
PF00970 FAD_binding_6 Oxidoreductase FAD-binding domain 1.8E-25 107 203
PF08030 NAD_binding_6 Ferric reductase NAD binding domain 6.9E-05 212 277

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Mitochondrial transit peptide 0.1101 0.1632 0.0821 0.0943 0.9142 0.0166 0.1479 0.0586 0.0968 0.0102

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3781
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5260
Ophiocordyceps australis map64 (Brazil) OphauB2|4450
Ophiocordyceps camponoti-floridani Ophcf2|03353 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|5897
Ophiocordyceps kimflemingae Ophio5|54
Ophiocordyceps subramaniannii Hirsu2|7377

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03353
MFARSAFRAARPLKTHARRYATETNAPNPSPSKKSPSPDEIEKKSPSSAWLSFAAATLAAGGCYWLMFGSSTPSP
AQQAAAKAKLAAGAGTTTKAALTGGDQGFVPLKLAGVETVNHNTKKFRFELPEGDMVSGLHVASAVLTRFKGEGE
EKATVRPYTPVSDENEKGHLDLLVKKYPNGPMSTHLHDLQPGQTLDFKGPLPKYPWTENKHQHIGLIAGGTGITP
MYQLLRAILQNPRDKTKVTLVFGNISEADILLRKELNELENTYPQRFRAFYTVDEPPKIKAEWGGATGFITKELL
REVLPEPKGGDVKVFVCGPPGLMKAISGAKTSPKDQGELTGALKELGYDKEQVYKF*
Coding >Ophcf2|03353
ATGTTCGCTCGATCGGCTTTCCGTGCGGCTCGACCGCTGAAGACGCATGCCCGCCGCTACGCCACGGAAACCAAC
GCCCCGAATCCATCCCCATCGAAGAAATCCCCAAGCCCCGACGAAATCGAAAAGAAAAGCCCTTCATCCGCATGG
CTCTCCTTCGCGGCCGCAACCCTCGCCGCCGGCGGTTGCTACTGGCTCATGTTCGGCAGCAGCACGCCCTCGCCA
GCCCAGCAAGCCGCCGCGAAAGCCAAGCTAGCAGCCGGTGCGGGCACGACGACCAAGGCGGCTCTCACGGGCGGC
GATCAGGGCTTCGTGCCGTTGAAGCTGGCGGGGGTCGAGACGGTCAACCATAACACCAAGAAGTTTCGGTTTGAG
CTTCCTGAGGGGGATATGGTTTCGGGCTTGCATGTTGCTAGTGCTGTTTTGACGAGGTTTAAGGGTGAGGGCGAG
GAGAAGGCTACTGTTCGGCCTTATACGCCCGTCAGCGATGAGAATGAAAAGGGCCATCTCGACCTCCTCGTCAAG
AAATACCCCAACGGTCCAATGAGCACTCACCTCCACGACTTGCAACCAGGCCAAACCCTCGACTTCAAAGGCCCC
CTCCCCAAATACCCCTGGACAGAAAACAAGCACCAACACATCGGCCTCATCGCCGGCGGAACCGGCATAACCCCA
ATGTACCAACTCCTCCGCGCCATCCTCCAAAACCCGCGCGACAAGACCAAAGTCACCCTCGTCTTCGGCAACATC
TCCGAAGCCGACATCCTCCTCCGCAAGGAACTGAACGAGCTGGAGAATACGTACCCGCAGCGTTTCCGCGCTTTT
TACACGGTCGATGAGCCGCCCAAGATCAAGGCTGAGTGGGGGGGGGCTACGGGCTTCATTACCAAGGAGTTGCTC
AGGGAGGTTTTGCCGGAGCCCAAGGGGGGGGATGTCAAGGTCTTCGTTTGCGGGCCTCCTGGACTCATGAAGGCT
ATCTCTGGGGCGAAGACGAGTCCCAAAGATCAGGGGGAGTTGACGGGTGCTCTGAAGGAGCTGGGCTATGATAAG
GAGCAGGTCTACAAGTTTTAG
Transcript >Ophcf2|03353
ATGTTCGCTCGATCGGCTTTCCGTGCGGCTCGACCGCTGAAGACGCATGCCCGCCGCTACGCCACGGAAACCAAC
GCCCCGAATCCATCCCCATCGAAGAAATCCCCAAGCCCCGACGAAATCGAAAAGAAAAGCCCTTCATCCGCATGG
CTCTCCTTCGCGGCCGCAACCCTCGCCGCCGGCGGTTGCTACTGGCTCATGTTCGGCAGCAGCACGCCCTCGCCA
GCCCAGCAAGCCGCCGCGAAAGCCAAGCTAGCAGCCGGTGCGGGCACGACGACCAAGGCGGCTCTCACGGGCGGC
GATCAGGGCTTCGTGCCGTTGAAGCTGGCGGGGGTCGAGACGGTCAACCATAACACCAAGAAGTTTCGGTTTGAG
CTTCCTGAGGGGGATATGGTTTCGGGCTTGCATGTTGCTAGTGCTGTTTTGACGAGGTTTAAGGGTGAGGGCGAG
GAGAAGGCTACTGTTCGGCCTTATACGCCCGTCAGCGATGAGAATGAAAAGGGCCATCTCGACCTCCTCGTCAAG
AAATACCCCAACGGTCCAATGAGCACTCACCTCCACGACTTGCAACCAGGCCAAACCCTCGACTTCAAAGGCCCC
CTCCCCAAATACCCCTGGACAGAAAACAAGCACCAACACATCGGCCTCATCGCCGGCGGAACCGGCATAACCCCA
ATGTACCAACTCCTCCGCGCCATCCTCCAAAACCCGCGCGACAAGACCAAAGTCACCCTCGTCTTCGGCAACATC
TCCGAAGCCGACATCCTCCTCCGCAAGGAACTGAACGAGCTGGAGAATACGTACCCGCAGCGTTTCCGCGCTTTT
TACACGGTCGATGAGCCGCCCAAGATCAAGGCTGAGTGGGGGGGGGCTACGGGCTTCATTACCAAGGAGTTGCTC
AGGGAGGTTTTGCCGGAGCCCAAGGGGGGGGATGTCAAGGTCTTCGTTTGCGGGCCTCCTGGACTCATGAAGGCT
ATCTCTGGGGCGAAGACGAGTCCCAAAGATCAGGGGGAGTTGACGGGTGCTCTGAAGGAGCTGGGCTATGATAAG
GAGCAGGTCTACAAGTTTTAG
Gene >Ophcf2|03353
ATGTTCGCTCGATCGGCTTTCCGTGCGGCTCGACCGCTGAAGACGGTAAGTAGACCGACCCAGACAGGTCTGAAG
GTACGGAAACAAAGGTCCAGCTCCCATCTAACAGTTCCATTCCCCCCATATCGACAGCATGCCCGCCGCTACGCC
ACGGAAACCAACGCCCCGAATCCATCCCCATCGAAGAAATCCCCAAGCCCCGACGAAATCGAAAAGAAAAGCCCT
TCATCCGCATGGCTCTCCTTCGCGGCCGCAACCCTCGCCGCCGGCGGTTGCTACTGGCTCATGTTCGGCAGCAGC
ACGCCCTCGCCAGCCCAGCAAGCCGCCGCGAAAGCCAAGCTAGCAGCCGGTGCGGGCACGACGACCAAGGCGGCT
CTCACGGGCGGCGATCAGGGCTTCGTGCCGTTGAAGCTGGCGGGGGTCGAGACGGTCAACCATAACACCAAGAAG
TTTCGGTTTGAGCTTCCTGAGGGGGATATGGTTTCGGGCTTGCATGTTGCTAGTGCTGTTTTGACGAGGTTTAAG
GGTGAGGGCGAGGAGAAGGCTACTGTTCGGCCTTATACGCCCGTCAGCGATGAGAGTTCGTCTCCTTGATTCTTC
CTTGGCCAGACTTTTTCACTAACAATCCAACAGATGAAAAGGGCCATCTCGACCTCCTCGTCAAGAAATACCCCA
ACGGTCCAATGAGCACTCACCTCCACGACTTGCAACCAGGCCAAACCCTCGACTTCAAAGGCCCCCTCCCCAAAT
ACCCCTGGACAGAAAACAAGCACCAACACATCGGCCTCATCGCCGGCGGAACCGGCATAACCCCAATGTACCAAC
TCCTCCGCGCCATCCTCCAAAACCCGCGCGACAAGACCAAAGTCACCCTCGTCTTCGGCAACATCTCCGAAGCCG
ACATCCTCCTCCGCAAGGAACTGAACGAGCTGGAGAATACGTACCCGCAGCGTTTCCGCGCTTTTTACACGGTCG
ATGAGCCGCCCAAGATCAAGGCTGAGTGGGGGGGGGCTACGGGCTTCATTACCAAGGAGTTGCTCAGGGAGGTTT
TGCCGGAGCCCAAGGGGGGGGATGTCAAGGTCTTCGTTTGCGGGCCTCCTGGACTCATGAAGGCTATCTCTGGGG
CGAAGACGAGTCCCAAAGATCAGGGGGAGTTGACGGGTGCTCTGAAGGAGCTGGGCTATGATAAGGAGCAGGTCT
ACAAGTTTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail