Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03351
Gene name
Locationscaffold_03:2436679..2442360
Strand-
Gene length (bp)5681
Transcript length (bp)3459
Coding sequence length (bp)3459
Protein length (aa) 1153

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04722 Ssu72 Ssu72-like protein 3.4E-84 27 255
PF08518 GIT_SHD Spa2 homology domain (SHD) of GIT 2.8E-14 490 517
PF08518 GIT_SHD Spa2 homology domain (SHD) of GIT 2.2E-07 547 573

GO

GO Term Description Terminal node
GO:0006397 mRNA processing Yes
GO:0005634 nucleus Yes
GO:0004721 phosphoprotein phosphatase activity Yes
GO:0110165 cellular anatomical entity No
GO:0006396 RNA processing No
GO:0044237 cellular metabolic process No
GO:0009987 cellular process No
GO:0042578 phosphoric ester hydrolase activity No
GO:0008152 metabolic process No
GO:0043227 membrane-bounded organelle No
GO:0046483 heterocycle metabolic process No
GO:0043231 intracellular membrane-bounded organelle No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0140096 catalytic activity, acting on a protein No
GO:0043170 macromolecule metabolic process No
GO:0003824 catalytic activity No
GO:1901360 organic cyclic compound metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0005575 cellular_component No
GO:0006807 nitrogen compound metabolic process No
GO:0016787 hydrolase activity No
GO:0043229 intracellular organelle No
GO:0016070 RNA metabolic process No
GO:0003674 molecular_function No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0016791 phosphatase activity No
GO:0090304 nucleic acid metabolic process No
GO:0016071 mRNA metabolic process No
GO:0008150 biological_process No
GO:0043226 organelle No
GO:0034641 cellular nitrogen compound metabolic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.6139 0.356 0.1611 0.1329 0.206 0.021 0.2088 0.3291 0.3146 0.0024

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3111
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5257
Ophiocordyceps australis map64 (Brazil) OphauB2|4453
Ophiocordyceps camponoti-floridani Ophcf2|03351 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6052
Ophiocordyceps kimflemingae Ophio5|57
Ophiocordyceps subramaniannii Hirsu2|5442

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03351
MESVNGSAAAAASAPNGSEGAPGSFKLKFCTVCASNQNRSMEAHLRLSQANYPVISFGTGSLVRLPGPTITQPNV
YQFNKTSYDSMYKELEAKDPRLYRNNGILNMLDRNREVKWGPERWQDWAVGLPRLQHVKDRGFEGTEGGVVDVVF
TCEERCWDAVIDDLLSRGSPLNRPVHVINVDIKDNHEEAHVGGQGILDLANSLNAAAVEEREAMGSAKFDSGSAA
GRASFDERVPEILGAWQERWPHLPATWTIACIRATGKGPLAARQKVVASGAGRTEDGGRGEDGPRLGGGGIYVER
PRTGRFTIVASAIFLQDARRSKQPSRGQCSRWGRQLSLVVVSPPRLRSYRPAPFPRPIMSVGGRNAPLSPISIGG
SEWSFSSQKARPLEGGDPYSANRGNLISPPQSGGSNGNMSINGFPPGPRSNGGPSPPPSVGRSSNGTNLFTSRSE
GNRNSARTEIDESLLQEHYLALRAFLNTRDANNRQQPNKARDKLLRLSSVQFHELSTDVYDELMRRQAAARAPPN
IPNGPPSFLLPEKTFHPKRNQARQRLSSLGPPRFRDLAGDVFHELERRFPYFVAGDIPRIGSAASNRNGPMNRMG
TPVNGAPYPPRGPSRMRRPSDASSARGGAPPPPNDPYSIPPSPGVVNGDYNRPMPKQPQNNTIVPNKSTMLEEDD
DNAADDDGGDVFSLERVADAPNSARMGDGGPTAETDKRIQDYQVQVRELQDKLDGMEDAMRRKEDEMSNVLDGER
SRATAVNMEKKELSGLRLKLENKLAEAQSLNKSMKEELERVRQDHDEETRLLRDEISALQQSSRNGRMGNVSADV
QRENDELRESLRQQRQVTDEVRREAQEFLREMRSLSQQSEATYEKQAAMEKTIEQLEREAREWRNRYERAKTQAR
DMRASSLGLPREQDAAQYVRDKGFLSSGGLVKDVHVVKFQTAIDEMLQTARQEVPEKVMEAMKSVVVSVRRITRD
LDESGPNDDELAQQQVRLKAKVSSTANSLITASKNFAAGAGISPVSLLDAAASHLTAAIVELLRVVKIRVTPAGE
LEDDDDGTMTPVDSTAFFSPRSLTQASGTQERLPPPPPFQGIGNMRASAESSAYSPVSSPRASVEQYQNGGTNGV
SNGGGMDYMGLKGYGMPQRAYGAFGGS*
Coding >Ophcf2|03351
ATGGAGTCGGTAAACGGTTCTGCGGCGGCGGCGGCCTCGGCGCCAAACGGCTCGGAGGGTGCGCCGGGCTCGTTT
AAGCTGAAATTCTGCACAGTCTGTGCCAGCAATCAGAATCGTTCCATGGAGGCTCATCTGCGGCTCTCACAAGCC
AACTACCCCGTCATCTCTTTTGGCACCGGCTCACTGGTGCGTCTGCCCGGGCCGACCATTACGCAGCCAAACGTC
TACCAATTCAACAAGACGTCGTACGACAGCATGTACAAGGAGCTCGAGGCCAAGGACCCGCGGCTGTATAGAAAC
AACGGCATTCTCAACATGCTGGACAGGAACAGAGAGGTCAAGTGGGGACCCGAGAGGTGGCAGGACTGGGCTGTC
GGTCTCCCGCGTCTGCAGCACGTCAAAGACCGCGGGTTCGAAGGCACAGAGGGCGGTGTCGTGGATGTCGTATTC
ACTTGTGAGGAACGCTGCTGGGACGCCGTCATTGACGACCTCCTGAGCAGGGGCTCCCCGCTGAACCGCCCTGTG
CATGTCATCAATGTTGACATCAAGGATAACCACGAGGAGGCTCATGTCGGTGGTCAGGGCATCCTCGACCTGGCC
AACTCGCTCAACGCCGCCGCCGTCGAGGAACGTGAAGCCATGGGGTCGGCAAAGTTTGACAGCGGAAGCGCGGCG
GGCCGTGCCAGCTTTGACGAGCGTGTGCCGGAGATTCTGGGCGCCTGGCAGGAACGCTGGCCGCATCTTCCAGCG
ACGTGGACGATTGCTTGTATCAGGGCAACGGGGAAGGGTCCTCTTGCGGCGAGACAAAAGGTCGTGGCGTCCGGA
GCAGGCCGGACGGAAGATGGCGGCCGGGGAGAAGACGGACCCCGGCTGGGGGGGGGGGGGATCTACGTAGAGCGG
CCTCGCACTGGCCGTTTCACAATCGTCGCCTCGGCCATCTTTCTCCAAGACGCTCGCAGAAGCAAGCAGCCAAGT
CGAGGGCAGTGCAGCCGGTGGGGAAGACAACTAAGTCTCGTCGTCGTCTCTCCTCCGAGGCTACGCTCTTACCGG
CCGGCTCCGTTTCCTCGCCCGATCATGAGCGTCGGTGGTCGCAATGCGCCGCTGTCTCCCATCTCCATAGGCGGA
AGCGAATGGTCATTCTCTTCCCAGAAAGCCCGCCCCCTGGAAGGAGGCGACCCCTATTCTGCCAATCGCGGCAAC
CTCATATCACCACCTCAGTCCGGCGGCTCCAACGGGAATATGAGCATCAATGGCTTCCCCCCGGGGCCCAGGAGC
AACGGGGGACCCTCGCCACCGCCTTCGGTTGGCCGCTCAAGCAATGGCACCAACCTCTTCACTTCCCGGAGCGAA
GGCAACCGCAATAGCGCCCGCACCGAGATCGACGAATCACTCCTCCAAGAACATTATCTCGCCCTCAGGGCCTTT
CTCAACACCCGCGACGCCAACAACCGCCAGCAACCCAACAAGGCCCGCGATAAGCTCCTGCGCCTCTCGTCTGTT
CAGTTCCACGAGCTCAGCACCGATGTCTATGACGAGTTGATGCGCCGCCAAGCTGCGGCTCGCGCGCCCCCGAAT
ATCCCCAATGGGCCTCCCTCTTTCCTCCTCCCCGAAAAGACGTTCCATCCGAAACGGAATCAGGCCCGTCAGAGG
CTCTCCTCGCTGGGACCCCCGCGCTTCCGGGATCTCGCCGGGGATGTCTTCCACGAGCTCGAGAGGCGTTTTCCT
TACTTCGTCGCCGGAGATATCCCACGCATCGGGAGCGCCGCCTCGAACCGCAACGGCCCCATGAACCGCATGGGC
ACGCCCGTCAACGGCGCCCCGTATCCTCCGAGGGGGCCGAGTCGCATGCGGAGGCCCTCTGACGCGAGTTCCGCC
CGCGGGGGAGCGCCCCCCCCTCCGAACGATCCTTACTCCATCCCGCCATCCCCCGGAGTGGTCAATGGCGACTAC
AACCGGCCGATGCCTAAGCAGCCTCAGAACAACACCATCGTACCCAACAAGAGCACCATGCTCGAGGAGGACGAC
GATAACGCCGCCGACGACGATGGGGGCGACGTCTTTAGCCTGGAACGAGTCGCCGACGCACCCAACAGCGCCCGC
ATGGGAGACGGCGGTCCGACGGCCGAGACCGACAAACGCATCCAAGACTACCAGGTGCAGGTCCGGGAGTTGCAA
GACAAGCTAGATGGCATGGAGGATGCCATGAGGAGGAAAGAGGACGAGATGAGCAACGTTCTGGACGGAGAGAGG
TCACGGGCGACGGCCGTGAACATGGAAAAGAAGGAATTATCGGGTCTCCGGCTGAAACTGGAGAATAAGCTGGCC
GAAGCGCAGAGTCTTAATAAGTCGATGAAGGAGGAGCTCGAACGGGTGCGCCAGGACCACGACGAGGAGACACGA
CTTCTCCGGGACGAGATTTCGGCCCTCCAACAGAGCTCGAGAAACGGACGGATGGGCAACGTGAGCGCCGACGTT
CAGCGAGAAAACGACGAGCTCCGCGAGTCCCTTCGACAGCAGCGGCAGGTGACGGACGAGGTGCGACGAGAGGCG
CAAGAGTTTCTCCGCGAGATGAGGTCGCTGTCTCAGCAGAGCGAGGCGACGTATGAGAAGCAGGCGGCCATGGAG
AAGACGATTGAGCAGTTGGAGCGCGAGGCGCGCGAATGGAGGAACCGGTACGAGCGGGCCAAGACGCAGGCGCGC
GATATGCGGGCGTCGTCGCTGGGCCTCCCGCGGGAGCAGGACGCGGCGCAGTACGTGCGGGACAAGGGCTTCCTG
AGCAGCGGCGGGCTCGTCAAGGACGTGCACGTTGTCAAGTTCCAGACGGCCATTGACGAGATGCTGCAGACGGCG
CGACAGGAGGTGCCGGAAAAGGTCATGGAGGCGATGAAGTCGGTCGTCGTCAGCGTCCGGCGCATTACGAGGGAC
CTGGACGAGTCGGGACCCAACGACGACGAGCTGGCGCAGCAGCAGGTCAGGCTCAAGGCCAAGGTGTCGTCGACG
GCCAACAGTCTCATCACGGCGTCCAAGAACTTTGCGGCGGGCGCGGGCATCTCTCCCGTTTCTCTTCTGGACGCG
GCGGCGTCGCACTTGACGGCTGCCATTGTCGAGCTGCTGCGCGTCGTCAAGATCCGGGTGACGCCGGCGGGCGAG
CTCGAGGACGACGACGACGGCACCATGACGCCCGTCGACTCGACGGCCTTCTTTTCGCCCCGGAGTCTGACGCAG
GCATCCGGCACACAGGAGAGGCTGCCTCCGCCGCCGCCGTTCCAGGGCATCGGCAACATGCGGGCCAGCGCCGAG
TCGTCGGCCTACAGCCCCGTCAGCTCGCCGCGCGCTTCGGTGGAGCAGTACCAGAACGGCGGCACCAACGGCGTG
AGCAACGGCGGCGGCATGGACTACATGGGGCTCAAGGGGTACGGGATGCCGCAGCGAGCATACGGCGCGTTTGGC
GGCTCCTGA
Transcript >Ophcf2|03351
ATGGAGTCGGTAAACGGTTCTGCGGCGGCGGCGGCCTCGGCGCCAAACGGCTCGGAGGGTGCGCCGGGCTCGTTT
AAGCTGAAATTCTGCACAGTCTGTGCCAGCAATCAGAATCGTTCCATGGAGGCTCATCTGCGGCTCTCACAAGCC
AACTACCCCGTCATCTCTTTTGGCACCGGCTCACTGGTGCGTCTGCCCGGGCCGACCATTACGCAGCCAAACGTC
TACCAATTCAACAAGACGTCGTACGACAGCATGTACAAGGAGCTCGAGGCCAAGGACCCGCGGCTGTATAGAAAC
AACGGCATTCTCAACATGCTGGACAGGAACAGAGAGGTCAAGTGGGGACCCGAGAGGTGGCAGGACTGGGCTGTC
GGTCTCCCGCGTCTGCAGCACGTCAAAGACCGCGGGTTCGAAGGCACAGAGGGCGGTGTCGTGGATGTCGTATTC
ACTTGTGAGGAACGCTGCTGGGACGCCGTCATTGACGACCTCCTGAGCAGGGGCTCCCCGCTGAACCGCCCTGTG
CATGTCATCAATGTTGACATCAAGGATAACCACGAGGAGGCTCATGTCGGTGGTCAGGGCATCCTCGACCTGGCC
AACTCGCTCAACGCCGCCGCCGTCGAGGAACGTGAAGCCATGGGGTCGGCAAAGTTTGACAGCGGAAGCGCGGCG
GGCCGTGCCAGCTTTGACGAGCGTGTGCCGGAGATTCTGGGCGCCTGGCAGGAACGCTGGCCGCATCTTCCAGCG
ACGTGGACGATTGCTTGTATCAGGGCAACGGGGAAGGGTCCTCTTGCGGCGAGACAAAAGGTCGTGGCGTCCGGA
GCAGGCCGGACGGAAGATGGCGGCCGGGGAGAAGACGGACCCCGGCTGGGGGGGGGGGGGATCTACGTAGAGCGG
CCTCGCACTGGCCGTTTCACAATCGTCGCCTCGGCCATCTTTCTCCAAGACGCTCGCAGAAGCAAGCAGCCAAGT
CGAGGGCAGTGCAGCCGGTGGGGAAGACAACTAAGTCTCGTCGTCGTCTCTCCTCCGAGGCTACGCTCTTACCGG
CCGGCTCCGTTTCCTCGCCCGATCATGAGCGTCGGTGGTCGCAATGCGCCGCTGTCTCCCATCTCCATAGGCGGA
AGCGAATGGTCATTCTCTTCCCAGAAAGCCCGCCCCCTGGAAGGAGGCGACCCCTATTCTGCCAATCGCGGCAAC
CTCATATCACCACCTCAGTCCGGCGGCTCCAACGGGAATATGAGCATCAATGGCTTCCCCCCGGGGCCCAGGAGC
AACGGGGGACCCTCGCCACCGCCTTCGGTTGGCCGCTCAAGCAATGGCACCAACCTCTTCACTTCCCGGAGCGAA
GGCAACCGCAATAGCGCCCGCACCGAGATCGACGAATCACTCCTCCAAGAACATTATCTCGCCCTCAGGGCCTTT
CTCAACACCCGCGACGCCAACAACCGCCAGCAACCCAACAAGGCCCGCGATAAGCTCCTGCGCCTCTCGTCTGTT
CAGTTCCACGAGCTCAGCACCGATGTCTATGACGAGTTGATGCGCCGCCAAGCTGCGGCTCGCGCGCCCCCGAAT
ATCCCCAATGGGCCTCCCTCTTTCCTCCTCCCCGAAAAGACGTTCCATCCGAAACGGAATCAGGCCCGTCAGAGG
CTCTCCTCGCTGGGACCCCCGCGCTTCCGGGATCTCGCCGGGGATGTCTTCCACGAGCTCGAGAGGCGTTTTCCT
TACTTCGTCGCCGGAGATATCCCACGCATCGGGAGCGCCGCCTCGAACCGCAACGGCCCCATGAACCGCATGGGC
ACGCCCGTCAACGGCGCCCCGTATCCTCCGAGGGGGCCGAGTCGCATGCGGAGGCCCTCTGACGCGAGTTCCGCC
CGCGGGGGAGCGCCCCCCCCTCCGAACGATCCTTACTCCATCCCGCCATCCCCCGGAGTGGTCAATGGCGACTAC
AACCGGCCGATGCCTAAGCAGCCTCAGAACAACACCATCGTACCCAACAAGAGCACCATGCTCGAGGAGGACGAC
GATAACGCCGCCGACGACGATGGGGGCGACGTCTTTAGCCTGGAACGAGTCGCCGACGCACCCAACAGCGCCCGC
ATGGGAGACGGCGGTCCGACGGCCGAGACCGACAAACGCATCCAAGACTACCAGGTGCAGGTCCGGGAGTTGCAA
GACAAGCTAGATGGCATGGAGGATGCCATGAGGAGGAAAGAGGACGAGATGAGCAACGTTCTGGACGGAGAGAGG
TCACGGGCGACGGCCGTGAACATGGAAAAGAAGGAATTATCGGGTCTCCGGCTGAAACTGGAGAATAAGCTGGCC
GAAGCGCAGAGTCTTAATAAGTCGATGAAGGAGGAGCTCGAACGGGTGCGCCAGGACCACGACGAGGAGACACGA
CTTCTCCGGGACGAGATTTCGGCCCTCCAACAGAGCTCGAGAAACGGACGGATGGGCAACGTGAGCGCCGACGTT
CAGCGAGAAAACGACGAGCTCCGCGAGTCCCTTCGACAGCAGCGGCAGGTGACGGACGAGGTGCGACGAGAGGCG
CAAGAGTTTCTCCGCGAGATGAGGTCGCTGTCTCAGCAGAGCGAGGCGACGTATGAGAAGCAGGCGGCCATGGAG
AAGACGATTGAGCAGTTGGAGCGCGAGGCGCGCGAATGGAGGAACCGGTACGAGCGGGCCAAGACGCAGGCGCGC
GATATGCGGGCGTCGTCGCTGGGCCTCCCGCGGGAGCAGGACGCGGCGCAGTACGTGCGGGACAAGGGCTTCCTG
AGCAGCGGCGGGCTCGTCAAGGACGTGCACGTTGTCAAGTTCCAGACGGCCATTGACGAGATGCTGCAGACGGCG
CGACAGGAGGTGCCGGAAAAGGTCATGGAGGCGATGAAGTCGGTCGTCGTCAGCGTCCGGCGCATTACGAGGGAC
CTGGACGAGTCGGGACCCAACGACGACGAGCTGGCGCAGCAGCAGGTCAGGCTCAAGGCCAAGGTGTCGTCGACG
GCCAACAGTCTCATCACGGCGTCCAAGAACTTTGCGGCGGGCGCGGGCATCTCTCCCGTTTCTCTTCTGGACGCG
GCGGCGTCGCACTTGACGGCTGCCATTGTCGAGCTGCTGCGCGTCGTCAAGATCCGGGTGACGCCGGCGGGCGAG
CTCGAGGACGACGACGACGGCACCATGACGCCCGTCGACTCGACGGCCTTCTTTTCGCCCCGGAGTCTGACGCAG
GCATCCGGCACACAGGAGAGGCTGCCTCCGCCGCCGCCGTTCCAGGGCATCGGCAACATGCGGGCCAGCGCCGAG
TCGTCGGCCTACAGCCCCGTCAGCTCGCCGCGCGCTTCGGTGGAGCAGTACCAGAACGGCGGCACCAACGGCGTG
AGCAACGGCGGCGGCATGGACTACATGGGGCTCAAGGGGTACGGGATGCCGCAGCGAGCATACGGCGCGTTTGGC
GGCTCCTGA
Gene >Ophcf2|03351
ATGGAGTCGGTAAACGGTTCTGCGGCGGCGGCGGCCTCGGCGCCAAACGGCTCGGAGGGTGCGCCGGGCTCGTTT
AAGCTGAAATTCTGCACAGTCTGTGCCAGCAATCAGAATCGGTAAGCCGGTGGCCCTGTTCGTAGCCAGGCTGGG
TCGCTGACGACGACGTCAGTTCCATGGAGGCTCATCTGCGGCTCTCACAAGCCAACTACCCCGTCATCTCTTTTG
GCACCGGCTCACTGGTGCGTCTGCCCGGGCCGACCATTACGCAGCCAAACGTCTACCAATTCAACAAGACGTCGT
ACGACAGCATGTACAAGGAGCTCGAGGCCAAGGACCCGCGGCTGTATAGAAACAACGGCATTCTCAACATGCTGG
ACAGGAACAGAGAGGTCAAGTGGGGACCCGAGAGGTGGCAGGACTGGGCTGTCGGTCTCCCGCGTCTGCAGCACG
TCAAAGACCGCGGGTTCGAAGGCACAGAGGGCGGTGTCGTGGATGTCGTATTCACTTGTGAGGAACGCTGCTGGG
ACGCCGTCATTGACGACCTCCTGAGCAGGGGCTCCCCGCTGAACCGCCCTGTGCATGTCATCAATGTTGACATCA
AGGATAACCACGAGGAGGCTCATGTCGGTGGTCAGGGCATCCTCGACCTGGCCAACTCGCTCAACGCCGCCGCCG
TCGAGGAACGTGAAGCCATGGGGTCGGCAAAGTTTGACAGCGGAAGCGCGGCGGGCCGTGCCAGCTTTGACGAGC
GTGTGCCGGAGATTCTGGGCGCCTGGCAGGAACGCTGGCCGCATCTTCCAGCGACGTGGACGATTGCTTGGTTCT
GATGGTTTCAGGCACAGCCGAGCAAGACACATTGACGGGATCGGGTTCGACTTGGCACGGTGGAAGATGCCGCGA
ACAGAGAATTACGGCTACCCGTTGACGACGGGGCACGGACGGGGCCATGGCTTTACAGGCTGTTTGTGACACCCT
GCCGCCCCCATGGAAGGGACGTATGTAGGTGTGCCACGCCTAAGGGCCCTTGAGTCGATCCTAGCTCGCTTACGG
CGGGCGCGCCATTGCCAGCTGGATGTCGTGCATTGCGACGGCCGCGTCCAGGCCACGGGCGATGGATGATGGATG
GGCGAAGGCGATAAAGGGAGGGCATGCAAAGGTTATTGTCCTCGGGGTTCTCCTCATGTCTCGCATCTGCGGCGC
TGAGATGAGGTCAGGGAACGGATAAATAGACATTGACATGGGGCGGGGCGGGGCGAAAGAGAGAGACGACGGCCT
GGGAAGGGAGAGTCTCGAGACAAGACCGAGCTTGGCCGGGCTCTGTATGTATGTATGTGTGAATCGGCGGTGCCC
TGATGGAGGCAGGGAAAGGTAGGAAGTGATACATGCATGCGGAATGTCGCAGGACGAGGCAGAAGAGACAGGCAA
GGCGGTAGGTACTCGACTCAGCTAGGCCCCTAGAGTGTTTAAATAGTCGACGCGACGGGAAAAGCGCGAGCACAT
GACGACAGATGTGTGCTGTATTCGTATACATGTTCATAGGTAATTTCAAAGAAGAGAGGCGAGGAAAGCAGAGAC
AGACTGTCACAGACACAACCGTTGAAGAGCCCGCGTTACATACATACATAGGTAGGTACATACAACCGTCTGATG
GCTTCCCCCCTTACGTGGACTGCTGTGTGTGTTCGGGTTGTGTATGTATGTATGTAGTTGACGCTGGCGGGGATA
GACCTGGTTTCCAGCCTAGCTGATTGATATGCAGGATGATGCTTGATGCCGGGAAGGCAGTCTCAGTATCAGGGC
AACGGGGAAGGGTCCTCTTGCGGCGAGACAAAAGGTCGTGGCGTCCGGAGCAGGCCGGACGGAAGATGGCGGCCG
GGGAGAAGACGGACCCCGGCTGGGGGGGGGGGGGATCTACGTAGAGCGGGTGCGTCCGCTGCCCAACCACCGTCT
GGGTAGGTTGCCTTAGTAGTGTGTAGGAAGGAGTGCAATCATCTCGCCAGCCGGGCCTTTCCTAACTGGCGCGGG
CGACGCGCGAGGAGGCCAGCTGATAGTGCAGCACAGTGCCATGATGTCGACCCTTCCACCCGCCGCAGTGGACGT
GATCCGAGCGCTCACTAAGAAGGATGGAGCGGATGCCTCGACCTACCTCAGTGTACCTACCTATCTACCTAGCTA
GATACATAGGTAGGCACATGATAGGTGAATACCTACAAATCTTACTAAGGTAGGTACCTCCAGCCTCCAGGCTAC
ATGGGCATAGGTACATGACAGGCTACCTGGCAGCAGCCGCCCCCTGCGATCCCAGCCTCCATCGCCCTGTCCGGC
CTAGCGGAGGATCAATCTTTGTGCAGCGCAGCAGGAGCGAGCTCAGGCCTCGGGCCCGTCTTCTACGGTGACCTA
CCTAGGTACAACTACTACCACATGTGTACCTAGGTACCCTATCTATCTACCTAGGTACAGGCTACAGGCTACAGC
TACGGGTCCGGGCAGGCTTGCAGGGACTATGGAGTGGGCGGGCGGCTTCTCTGTCTCTGTCGCTGTTTCTTCCCT
CAATCCAGTACCTGTAGGTAGGCACCTAGGTAGGTGTGTACATAGGTAGGTATGTAGGTACACACACACACGGGC
ATCCCATCAGAAAAAGGGCTTTTCTTTCTTTTAATCTCGTTAACCTTCTCTCCGTCTTCATCGGCCTGACAGCAT
CATACATACATACTGCCACTCCGTCACCCCCTACCCATCAAGGCCTTCAGGGGCGCACTGCTTCCAGCTCATTTC
CGGTTGGCCCCGGGCCGGACTGCCAACCGTCTCCCCCCCCCCCCCCCCCCTTTTTTTTCTCTCTTGTCCCCGCTG
CGAGGCTCGTCACAGTCTGGCTGGCCTCAGCCTCGCACTGGCCGTTTCACAATCGTCGCCTCGGCCATCTTTCTC
CAAGACGCTCGCAGAAGCAAGCAGCCAAGTCGAGTCCGTCTGCCCTTGTTGGATCGTGGCCCTCTCTCCCCGCTG
GCCATCCCTCCCTCTCTCTGCCTTCCGCCTGTTCCCTGTGAGCGCTGAACAGGCCTCTTTGTTACATTGATGTTT
TCTTTGTCCCCTCGACCCGTGTCCACTGATGAGCGTCCACTGACCGACCACTGAGCCACAGGGGCAGTGCAGCCG
GTGGGGAAGACAACTAAGTCTCGTCGTCGTCTCTCCTCCGAGGCTACGCTCTTACCGGCCGGCTCCGTTTCCTCG
CCCGATCATGAGCGTCGGTGGTCGCAATGCGCCGCTGTCTCCCATCTCCATAGGCGGAAGCGAATGGTCATTCTC
TTCCCAGAAAGCCCGCCCCCTGGAAGGAGGCGACCCCTATTCTGCCAATCGCGGCAACCTCATATCACCACCTCA
GTCCGGCGGCTCCAACGGGAATATGAGCATCAATGGCTTCCCCCCGGGGCCCAGGAGCAACGGGGGACCCTCGCC
ACCGCCTTCGGTTGGCCGCTCAAGCAATGGCACCAACCTCTTCACTTCCCGGAGCGAAGGCAACCGCAATAGCGC
CCGCACCGAGATCGACGAATCACTCCTCCAAGAACATTATCTCGCCCTCAGGGCCTTTCTCAACACCCGCGACGC
CAACAACCGCCAGCAACCCAACAAGGCCCGCGATAAGCTCCTGCGCCTCTCGTCTGTTCAGTTCCACGAGCTCAG
CACCGATGTCTATGACGAGTTGATGCGCCGCCAAGCTGCGGCTCGCGCGCCCCCGAATATCCCCAATGGGCCTCC
CTCTTTCCTCCTCCCCGAAAAGACGTTCCATCCGAAACGGAATCAGGCCCGTCAGAGGCTCTCCTCGCTGGGACC
CCCGCGCTTCCGGGATCTCGCCGGGGATGTCTTCCACGAGCTCGAGAGGCGTTTTCCTTACTTCGTCGCCGGAGA
TATCCCACGCATCGGGAGCGCCGCCTCGAACCGCAACGGCCCCATGAACCGCATGGGCACGCCCGTCAACGGCGC
CCCGTATCCTCCGAGGGGGCCGAGTCGCATGCGGAGGCCCTCTGACGCGAGTTCCGCCCGCGGGGGAGCGCCCCC
CCCTCCGAACGATCCTTACTCCATCCCGCCATCCCCCGGAGTGGTCAATGGCGACTACAACCGGCCGATGCCTAA
GCAGCCTCAGAACAACACCATCGTACCCAACAAGAGCACCATGCTCGAGGAGGACGACGATAACGCCGCCGACGA
CGATGGGGGCGACGTCTTTAGCCTGGAACGAGTCGCCGACGCACCCAACAGCGCCCGCATGGGAGACGGCGGTCC
GACGGCCGAGGTCCGCACCTACATACTCTTTTCTTTACCCCTGTTTCTGGAGGGCGAGCTAACCTGTGACGCAGA
CCGACAAACGCATCCAAGACTACCAGGTGCAGGTCCGGGAGTTGCAAGACAAGCTAGATGGCATGGAGGATGCCA
TGAGGAGGAAAGAGGACGAGATGAGCAACGTTCTGGACGGAGAGAGGTCACGGGCGACGGCCGTGAACATGGAAA
AGAAGGAATTATCGGGTCTCCGGCTGAAACTGGAGAATAAGCTGGCCGAAGCGCAGAGTCTTAATAAGTCGATGA
AGGAGGAGCTCGAACGGGTGCGCCAGGACCACGACGAGGAGACACGACTTCTCCGGGACGAGATTTCGGCCCTCC
AACAGAGCTCGAGAAACGGACGGATGGGCAACGTGAGCGCCGACGTTCAGCGAGAAAACGACGAGCTCCGCGAGT
CCCTTCGACAGCAGCGGCAGGTGACGGACGAGGTGCGACGAGAGGCGCAAGAGTTTCTCCGCGAGATGAGGTCGC
TGTCTCAGCAGAGCGAGGCGACGTATGAGAAGCAGGCGGCCATGGAGAAGACGATTGAGCAGTTGGAGCGCGAGG
CGCGCGAATGGAGGAACCGGTACGAGCGGGCCAAGACGCAGGCGCGCGATATGCGGGCGTCGTCGCTGGGCCTCC
CGCGGGAGCAGGACGCGGCGCAGTACGTGCGGGACAAGGGCTTCCTGAGCAGCGGCGGGCTCGTCAAGGACGTGC
ACGTTGTCAAGTTCCAGACGGCCATTGACGAGATGCTGCAGACGGCGCGACAGGAGGTGCCGGAAAAGGTCATGG
AGGCGATGAAGTCGGTCGTCGTCAGCGTCCGGCGCATTACGAGGGACCTGGACGAGTCGGGACCCAACGACGACG
AGCTGGCGCAGCAGCAGGTCAGGCTCAAGGCCAAGGTGTCGTCGACGGCCAACAGTCTCATCACGGCGTCCAAGA
ACTTTGCGGCGGGCGCGGGCATCTCTCCCGTTTCTCTTCTGGACGCGGCGGCGTCGCACTTGACGGCTGCCATTG
TCGAGCTGCTGCGCGTCGTCAAGATCCGGGTGACGCCGGCGGGCGAGCTCGAGGACGACGACGACGGCACCATGA
CGCCCGTCGACTCGACGGCCTTCTTTTCGCCCCGGAGTCTGACGCAGGCATCCGGCACACAGGAGAGGCTGCCTC
CGCCGCCGCCGTTCCAGGGCATCGGCAACATGCGGGCCAGCGCCGAGTCGTCGGCCTACAGCCCCGTCAGCTCGC
CGCGCGCTTCGGTGGAGCAGTACCAGAACGGCGGCACCAACGGCGTGAGCAACGGCGGCGGCATGGACTACATGG
GGCTCAAGGGGTACGGGATGCCGCAGCGAGCATACGGCGCGTTTGGCGGCTCCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail