Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03350
Gene name
Locationscaffold_03:2433778..2435233
Strand-
Gene length (bp)1455
Transcript length (bp)1455
Coding sequence length (bp)1455
Protein length (aa) 485

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02373 JmjC JmjC domain, hydroxylase 2.8E-19 254 356

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.2961 0.9355 0.2342 0.0121 0.0691 0.0029 0.0268 0.0267 0.0155 0.0012

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5886
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|600
Ophiocordyceps australis map64 (Brazil) OphauB2|4454
Ophiocordyceps camponoti-floridani Ophcf2|03350 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6053
Ophiocordyceps kimflemingae Ophio5|58

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03350
MDDDDGVDGGRRLGGGECRVEQPSVFGPGSVTVPAVAPVPVDALSLPGVSSARGLAEGGEVEDAATSPRLKDFEY
GFDHVDGHGVLHLRPTLEQWLDFPAVLAFARGMGVERDGCFKVSIPDSLLEAVPEKPAKRVSANAYKIRQIKKTT
FWQVSTVLSDGEFGGSSVSGEFSESVALALKNLKRLFRTNKDRQMRSVRYRVDVPAWTAKQRRDAGVPERSPIHP
LKGDKLDRTKAIIPGIHTPYVYESGPYFGATFQIHAEDFRLASLNHLYKGRKIWIVVPATAVDVAEAALGREKGC
SQFMRHRAEFFFPDKLDKLGIPYRLVDQRPGETMVILPDAYHEGFSTGYTIAEARNYADEGWNTDSYQPCQESCR
LATAIPASLMRVLGEGEERIDLCAAYGDDGRFGVPVGDAVSSLGDVASSLEQVDAPSPLTPVVTIPWPEPASNPK
KRALDPDEQRYAGQEGMEQRDAKRIRHEETSQSR*
Coding >Ophcf2|03350
ATGGACGACGATGACGGTGTTGACGGAGGGCGGAGATTGGGCGGGGGCGAGTGCCGGGTTGAGCAGCCCAGTGTC
TTTGGACCTGGTTCTGTTACGGTACCTGCGGTTGCGCCCGTGCCCGTCGATGCGCTTTCGCTTCCTGGTGTTTCG
TCTGCGAGGGGGCTTGCCGAAGGCGGAGAGGTTGAGGATGCTGCGACGTCGCCGAGGCTGAAGGATTTCGAGTAC
GGGTTCGACCACGTCGACGGCCATGGCGTGCTGCATCTGAGGCCTACGCTCGAACAGTGGCTTGACTTTCCTGCC
GTTCTCGCCTTTGCTAGGGGTATGGGTGTCGAGCGCGATGGCTGCTTCAAGGTTTCCATTCCCGACAGCTTGCTC
GAGGCGGTGCCGGAGAAGCCGGCCAAGCGGGTGTCGGCCAACGCCTACAAGATCAGGCAGATCAAGAAGACGACG
TTTTGGCAGGTCAGCACCGTGCTTTCCGATGGCGAGTTTGGTGGGTCTTCGGTCAGCGGCGAATTTTCCGAGAGT
GTCGCCCTGGCGCTCAAGAATCTCAAGCGCCTGTTTCGCACCAACAAGGATCGGCAGATGCGCAGCGTTCGGTAT
CGAGTCGACGTTCCTGCCTGGACGGCCAAGCAGAGACGCGACGCGGGCGTTCCAGAGAGGAGTCCCATCCATCCG
CTCAAGGGCGATAAGCTCGACCGCACAAAGGCCATCATCCCGGGCATACACACGCCCTACGTCTACGAGAGCGGG
CCCTACTTTGGAGCCACCTTTCAGATCCACGCCGAGGATTTCCGGCTCGCCTCGCTGAATCACCTGTACAAGGGC
CGCAAGATCTGGATCGTGGTGCCCGCTACGGCCGTCGACGTCGCCGAGGCGGCACTGGGTCGCGAGAAGGGCTGC
TCGCAGTTCATGCGCCACCGCGCCGAGTTCTTCTTCCCGGATAAGCTCGACAAGCTCGGGATCCCTTACCGGCTT
GTCGATCAGCGGCCGGGCGAGACCATGGTCATACTGCCCGATGCGTACCACGAGGGTTTCAGCACGGGCTACACG
ATTGCCGAGGCGAGGAATTACGCCGACGAGGGCTGGAACACGGATTCCTATCAGCCTTGTCAGGAGAGTTGTCGG
TTGGCGACGGCGATTCCGGCTTCGTTGATGAGGGTGCTCGGGGAGGGGGAGGAGAGGATCGATCTGTGTGCTGCG
TATGGGGATGATGGACGCTTCGGAGTTCCGGTGGGTGACGCTGTTTCTTCGCTGGGGGATGTTGCTTCTTCGTTG
GAACAGGTTGATGCTCCGTCGCCGCTCACTCCCGTCGTCACGATTCCTTGGCCAGAACCAGCATCGAATCCGAAG
AAGCGCGCCCTCGATCCCGACGAACAACGATACGCAGGGCAGGAGGGGATGGAGCAGCGCGATGCCAAGCGTATC
CGACACGAAGAGACCAGTCAGTCCCGATGA
Transcript >Ophcf2|03350
ATGGACGACGATGACGGTGTTGACGGAGGGCGGAGATTGGGCGGGGGCGAGTGCCGGGTTGAGCAGCCCAGTGTC
TTTGGACCTGGTTCTGTTACGGTACCTGCGGTTGCGCCCGTGCCCGTCGATGCGCTTTCGCTTCCTGGTGTTTCG
TCTGCGAGGGGGCTTGCCGAAGGCGGAGAGGTTGAGGATGCTGCGACGTCGCCGAGGCTGAAGGATTTCGAGTAC
GGGTTCGACCACGTCGACGGCCATGGCGTGCTGCATCTGAGGCCTACGCTCGAACAGTGGCTTGACTTTCCTGCC
GTTCTCGCCTTTGCTAGGGGTATGGGTGTCGAGCGCGATGGCTGCTTCAAGGTTTCCATTCCCGACAGCTTGCTC
GAGGCGGTGCCGGAGAAGCCGGCCAAGCGGGTGTCGGCCAACGCCTACAAGATCAGGCAGATCAAGAAGACGACG
TTTTGGCAGGTCAGCACCGTGCTTTCCGATGGCGAGTTTGGTGGGTCTTCGGTCAGCGGCGAATTTTCCGAGAGT
GTCGCCCTGGCGCTCAAGAATCTCAAGCGCCTGTTTCGCACCAACAAGGATCGGCAGATGCGCAGCGTTCGGTAT
CGAGTCGACGTTCCTGCCTGGACGGCCAAGCAGAGACGCGACGCGGGCGTTCCAGAGAGGAGTCCCATCCATCCG
CTCAAGGGCGATAAGCTCGACCGCACAAAGGCCATCATCCCGGGCATACACACGCCCTACGTCTACGAGAGCGGG
CCCTACTTTGGAGCCACCTTTCAGATCCACGCCGAGGATTTCCGGCTCGCCTCGCTGAATCACCTGTACAAGGGC
CGCAAGATCTGGATCGTGGTGCCCGCTACGGCCGTCGACGTCGCCGAGGCGGCACTGGGTCGCGAGAAGGGCTGC
TCGCAGTTCATGCGCCACCGCGCCGAGTTCTTCTTCCCGGATAAGCTCGACAAGCTCGGGATCCCTTACCGGCTT
GTCGATCAGCGGCCGGGCGAGACCATGGTCATACTGCCCGATGCGTACCACGAGGGTTTCAGCACGGGCTACACG
ATTGCCGAGGCGAGGAATTACGCCGACGAGGGCTGGAACACGGATTCCTATCAGCCTTGTCAGGAGAGTTGTCGG
TTGGCGACGGCGATTCCGGCTTCGTTGATGAGGGTGCTCGGGGAGGGGGAGGAGAGGATCGATCTGTGTGCTGCG
TATGGGGATGATGGACGCTTCGGAGTTCCGGTGGGTGACGCTGTTTCTTCGCTGGGGGATGTTGCTTCTTCGTTG
GAACAGGTTGATGCTCCGTCGCCGCTCACTCCCGTCGTCACGATTCCTTGGCCAGAACCAGCATCGAATCCGAAG
AAGCGCGCCCTCGATCCCGACGAACAACGATACGCAGGGCAGGAGGGGATGGAGCAGCGCGATGCCAAGCGTATC
CGACACGAAGAGACCAGTCAGTCCCGATGA
Gene >Ophcf2|03350
ATGGACGACGATGACGGTGTTGACGGAGGGCGGAGATTGGGCGGGGGCGAGTGCCGGGTTGAGCAGCCCAGTGTC
TTTGGACCTGGTTCTGTTACGGTACCTGCGGTTGCGCCCGTGCCCGTCGATGCGCTTTCGCTTCCTGGTGTTTCG
TCTGCGAGGGGGCTTGCCGAAGGCGGAGAGGTTGAGGATGCTGCGACGTCGCCGAGGCTGAAGGATTTCGAGTAC
GGGTTCGACCACGTCGACGGCCATGGCGTGCTGCATCTGAGGCCTACGCTCGAACAGTGGCTTGACTTTCCTGCC
GTTCTCGCCTTTGCTAGGGGTATGGGTGTCGAGCGCGATGGCTGCTTCAAGGTTTCCATTCCCGACAGCTTGCTC
GAGGCGGTGCCGGAGAAGCCGGCCAAGCGGGTGTCGGCCAACGCCTACAAGATCAGGCAGATCAAGAAGACGACG
TTTTGGCAGGTCAGCACCGTGCTTTCCGATGGCGAGTTTGGTGGGTCTTCGGTCAGCGGCGAATTTTCCGAGAGT
GTCGCCCTGGCGCTCAAGAATCTCAAGCGCCTGTTTCGCACCAACAAGGATCGGCAGATGCGCAGCGTTCGGTAT
CGAGTCGACGTTCCTGCCTGGACGGCCAAGCAGAGACGCGACGCGGGCGTTCCAGAGAGGAGTCCCATCCATCCG
CTCAAGGGCGATAAGCTCGACCGCACAAAGGCCATCATCCCGGGCATACACACGCCCTACGTCTACGAGAGCGGG
CCCTACTTTGGAGCCACCTTTCAGATCCACGCCGAGGATTTCCGGCTCGCCTCGCTGAATCACCTGTACAAGGGC
CGCAAGATCTGGATCGTGGTGCCCGCTACGGCCGTCGACGTCGCCGAGGCGGCACTGGGTCGCGAGAAGGGCTGC
TCGCAGTTCATGCGCCACCGCGCCGAGTTCTTCTTCCCGGATAAGCTCGACAAGCTCGGGATCCCTTACCGGCTT
GTCGATCAGCGGCCGGGCGAGACCATGGTCATACTGCCCGATGCGTACCACGAGGGTTTCAGCACGGGCTACACG
ATTGCCGAGGCGAGGAATTACGCCGACGAGGGCTGGAACACGGATTCCTATCAGCCTTGTCAGGAGAGTTGTCGG
TTGGCGACGGCGATTCCGGCTTCGTTGATGAGGGTGCTCGGGGAGGGGGAGGAGAGGATCGATCTGTGTGCTGCG
TATGGGGATGATGGACGCTTCGGAGTTCCGGTGGGTGACGCTGTTTCTTCGCTGGGGGATGTTGCTTCTTCGTTG
GAACAGGTTGATGCTCCGTCGCCGCTCACTCCCGTCGTCACGATTCCTTGGCCAGAACCAGCATCGAATCCGAAG
AAGCGCGCCCTCGATCCCGACGAACAACGATACGCAGGGCAGGAGGGGATGGAGCAGCGCGATGCCAAGCGTATC
CGACACGAAGAGACCAGTCAGTCCCGATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail