Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03344
Gene name
Locationscaffold_03:2417896..2418944
Strand+
Gene length (bp)1048
Transcript length (bp)996
Coding sequence length (bp)996
Protein length (aa) 332

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08213 COX24_C Mitochondrial mRNA-processing protein COX24, C-terminal 1.8E-07 298 329

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Mitochondrial transit peptide 0.1339 0.1648 0.0513 0.0731 0.9484 0.0064 0.0367 0.0165 0.0303 0.0075

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4608
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2460
Ophiocordyceps australis map64 (Brazil) OphauB2|4463
Ophiocordyceps camponoti-floridani Ophcf2|03344 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6807
Ophiocordyceps kimflemingae Ophio5|62
Ophiocordyceps subramaniannii Hirsu2|9666

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03344
MLPLSLRRAFAAGASRGLGSALAPAPPLMVQRRASSSKPSRPDNDASDVPADGRVAASSADRPAAVSSASSRADG
KQGDKRKRKQKEASPKRLPYVPETGHMTRDDLGLSSFFSQHRPISITQSIPMPVTDEHFGSMFAPRVKNNRSGPP
HNPLVEALAKSMAQIATPAHQHSDGVEAGTQPKNAEGSASGLHLDLEAMSGDFEPYSPPPLPQPTDPPATDDALD
YSARPFSLPHYRKLQAIITIERTYGPNPHYRVQVRSPRVVRSASERSFLERMARRQVLFQEAKAGRAGRAMQAIS
VRRQRKLRMKKKKYKKLQKRTRNIRRKVDRS*
Coding >Ophcf2|03344
ATGTTGCCCTTGTCGCTGCGACGCGCCTTTGCGGCTGGGGCTTCCCGAGGCCTCGGCTCGGCTCTGGCCCCCGCC
CCTCCGCTCATGGTGCAGCGGAGAGCGTCGTCATCAAAGCCTTCGAGGCCGGATAACGATGCCAGCGACGTGCCG
GCTGATGGCCGCGTCGCTGCCTCGTCTGCTGATCGCCCGGCCGCTGTGTCATCCGCCTCGTCCCGCGCTGACGGG
AAGCAAGGCGATAAGCGCAAGCGCAAGCAGAAGGAAGCGTCCCCCAAGAGACTCCCCTACGTCCCCGAGACGGGT
CACATGACAAGGGACGATCTCGGATTATCCTCCTTTTTCTCCCAGCATCGGCCCATCTCCATCACGCAGTCGATA
CCCATGCCCGTCACCGACGAGCATTTCGGCTCCATGTTTGCTCCGCGCGTCAAGAACAACAGATCAGGGCCCCCG
CACAACCCATTAGTTGAAGCGCTCGCGAAATCCATGGCGCAAATTGCTACTCCCGCTCATCAGCATTCAGACGGA
GTCGAGGCCGGGACCCAACCCAAAAACGCCGAGGGCTCCGCCTCAGGCTTACACCTAGACCTCGAGGCCATGTCG
GGCGACTTTGAGCCCTACAGCCCGCCCCCGCTCCCGCAGCCGACCGACCCGCCGGCAACGGACGACGCCCTGGAC
TACTCAGCCAGGCCCTTCTCCCTGCCGCATTACCGCAAGCTTCAAGCCATCATCACCATCGAACGGACGTATGGC
CCAAACCCCCACTACCGCGTTCAAGTCCGCAGCCCACGCGTCGTCCGCAGCGCTTCGGAACGCAGCTTTCTGGAG
CGCATGGCCCGGCGACAGGTCCTCTTCCAAGAGGCCAAGGCCGGGCGGGCCGGGCGGGCCATGCAGGCCATCAGC
GTCAGGCGGCAACGAAAGCTCAGGATGAAGAAGAAGAAGTACAAGAAGCTGCAGAAGCGCACGCGCAACATACGC
CGCAAGGTGGACCGGTCGTGA
Transcript >Ophcf2|03344
ATGTTGCCCTTGTCGCTGCGACGCGCCTTTGCGGCTGGGGCTTCCCGAGGCCTCGGCTCGGCTCTGGCCCCCGCC
CCTCCGCTCATGGTGCAGCGGAGAGCGTCGTCATCAAAGCCTTCGAGGCCGGATAACGATGCCAGCGACGTGCCG
GCTGATGGCCGCGTCGCTGCCTCGTCTGCTGATCGCCCGGCCGCTGTGTCATCCGCCTCGTCCCGCGCTGACGGG
AAGCAAGGCGATAAGCGCAAGCGCAAGCAGAAGGAAGCGTCCCCCAAGAGACTCCCCTACGTCCCCGAGACGGGT
CACATGACAAGGGACGATCTCGGATTATCCTCCTTTTTCTCCCAGCATCGGCCCATCTCCATCACGCAGTCGATA
CCCATGCCCGTCACCGACGAGCATTTCGGCTCCATGTTTGCTCCGCGCGTCAAGAACAACAGATCAGGGCCCCCG
CACAACCCATTAGTTGAAGCGCTCGCGAAATCCATGGCGCAAATTGCTACTCCCGCTCATCAGCATTCAGACGGA
GTCGAGGCCGGGACCCAACCCAAAAACGCCGAGGGCTCCGCCTCAGGCTTACACCTAGACCTCGAGGCCATGTCG
GGCGACTTTGAGCCCTACAGCCCGCCCCCGCTCCCGCAGCCGACCGACCCGCCGGCAACGGACGACGCCCTGGAC
TACTCAGCCAGGCCCTTCTCCCTGCCGCATTACCGCAAGCTTCAAGCCATCATCACCATCGAACGGACGTATGGC
CCAAACCCCCACTACCGCGTTCAAGTCCGCAGCCCACGCGTCGTCCGCAGCGCTTCGGAACGCAGCTTTCTGGAG
CGCATGGCCCGGCGACAGGTCCTCTTCCAAGAGGCCAAGGCCGGGCGGGCCGGGCGGGCCATGCAGGCCATCAGC
GTCAGGCGGCAACGAAAGCTCAGGATGAAGAAGAAGAAGTACAAGAAGCTGCAGAAGCGCACGCGCAACATACGC
CGCAAGGTGGACCGGTCGTGA
Gene >Ophcf2|03344
ATGTTGCCCTTGTCGCTGCGACGCGCCTTTGCGGCTGGGGCTTCCCGAGGCCTCGGCTCGGCTCTGGCCCCCGCC
CCTCCGCTCATGGTGCAGCGGAGAGCGTCGTCATCAAAGCCTTCGAGGCCGGATAACGATGCCAGCGACGTGCCG
GCTGATGGCCGCGTCGCTGCCTCGTCTGCTGATCGCCCGGCCGCTGTGTCATCCGCCTCGTCCCGCGCTGACGGG
AAGCAAGGCGATAAGCGCAAGCGCAAGCAGAAGGAAGCGTCCCCCAAGAGACTCCCCTACGTCCCCGAGACGGGT
CACATGACAAGGGACGGTGAGTTGGCTGCTGTACGCGCCGTTGGAGTTTCTGTCTGACTAGGTGCAAGATCTCGG
ATTATCCTCCTTTTTCTCCCAGCATCGGCCCATCTCCATCACGCAGTCGATACCCATGCCCGTCACCGACGAGCA
TTTCGGCTCCATGTTTGCTCCGCGCGTCAAGAACAACAGATCAGGGCCCCCGCACAACCCATTAGTTGAAGCGCT
CGCGAAATCCATGGCGCAAATTGCTACTCCCGCTCATCAGCATTCAGACGGAGTCGAGGCCGGGACCCAACCCAA
AAACGCCGAGGGCTCCGCCTCAGGCTTACACCTAGACCTCGAGGCCATGTCGGGCGACTTTGAGCCCTACAGCCC
GCCCCCGCTCCCGCAGCCGACCGACCCGCCGGCAACGGACGACGCCCTGGACTACTCAGCCAGGCCCTTCTCCCT
GCCGCATTACCGCAAGCTTCAAGCCATCATCACCATCGAACGGACGTATGGCCCAAACCCCCACTACCGCGTTCA
AGTCCGCAGCCCACGCGTCGTCCGCAGCGCTTCGGAACGCAGCTTTCTGGAGCGCATGGCCCGGCGACAGGTCCT
CTTCCAAGAGGCCAAGGCCGGGCGGGCCGGGCGGGCCATGCAGGCCATCAGCGTCAGGCGGCAACGAAAGCTCAG
GATGAAGAAGAAGAAGTACAAGAAGCTGCAGAAGCGCACGCGCAACATACGCCGCAAGGTGGACCGGTCGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail