Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03340
Gene name
Locationscaffold_03:2403536..2405388
Strand-
Gene length (bp)1852
Transcript length (bp)1674
Coding sequence length (bp)1674
Protein length (aa) 558

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08030 NAD_binding_6 Ferric reductase NAD binding domain 3.4E-22 375 540
PF08022 FAD_binding_8 FAD-binding domain 3.0E-20 254 364
PF01794 Ferric_reduct Ferric reductase like transmembrane component 6.2E-19 74 190

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 20 39 19
2 57 79 22
3 100 122 22
4 142 164 22
5 177 199 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03340
MAGTSKRMAFLRKQLAPNKLLFFFFFWGIHWAIFAYGWWKQESDARLAGLNKLQFSVWISRGAGLVLSVDGMLIL
LPVCRTIMRWIRPKLRILPLDENLWFHRQLAYALLFFTILHVAAHYVNFYNVQITQIRPVTALQIHYAQPGGITG
HIMLLCMLFMYTTAHHRIRQQSFESFWYTHHLFIPFMLALYTHTVGCFVRDSPLGFSPFEGDQYWEHCIGYLGWR
WEIWTGVLYTLERLYREVRARRRTCITRIIRHPYDAVEIQFSKPSFKYKAGQWLFLQVPSISKYQWHPFTITSCP
FDPYVSVHVRQVGDFTRALGDATGAGSAQSKLYDSVDPMGMYEVALQNGQQMPALRIDGPFGAPAEDVFENEIAV
LIGTGIGVTPWASILKNIWHLRNSPNPPTRLRRVEFIWVCRDTGSFEWFQTLLSSLEDQSKEAARLPGSSGVEFL
KIHTYLTQKLDIDTTQNIVLNSVGAQLDPLTELQSRTNFGRPDFRRLFTTMRNGILDRTYINGLEGSIRTNVGVY
FCGPSVAARDIKTACKTATTSEVRFRFWKEHF*
Coding >Ophcf2|03340
ATGGCGGGAACTTCCAAGCGAATGGCGTTTCTGCGCAAGCAGCTCGCCCCGAACAAGCTCCTCTTCTTCTTTTTC
TTCTGGGGCATCCACTGGGCCATCTTTGCGTACGGATGGTGGAAGCAAGAGTCTGACGCCCGTCTCGCGGGTCTC
AACAAGCTACAATTCTCTGTCTGGATCTCTCGTGGCGCCGGTCTCGTCCTATCGGTAGACGGCATGCTCATCCTC
TTGCCCGTCTGCCGCACCATCATGCGCTGGATCCGGCCCAAACTCCGAATCCTCCCCCTGGACGAGAACCTCTGG
TTTCACCGTCAGCTCGCCTACGCTCTCCTCTTCTTCACCATACTCCACGTGGCAGCGCACTACGTCAACTTCTAC
AACGTTCAGATTACGCAGATCCGGCCGGTGACGGCGCTTCAGATCCACTACGCGCAGCCGGGCGGTATCACAGGC
CACATCATGCTGCTCTGCATGCTCTTCATGTACACGACAGCCCATCACCGGATCCGCCAGCAGTCGTTCGAATCG
TTCTGGTACACGCACCACCTCTTCATCCCCTTTATGCTGGCTCTCTACACCCACACCGTCGGCTGCTTCGTCCGC
GACTCGCCTCTGGGCTTCTCACCCTTCGAGGGCGATCAGTACTGGGAGCACTGCATTGGCTACCTCGGCTGGCGC
TGGGAGATCTGGACGGGCGTTTTGTACACGCTCGAACGGCTATATCGCGAGGTCCGCGCCCGGAGACGGACCTGC
ATCACGCGCATCATCCGTCATCCGTACGACGCCGTCGAGATTCAGTTCAGCAAGCCGTCCTTCAAGTACAAGGCC
GGCCAGTGGCTATTCCTCCAGGTGCCGTCCATCTCCAAGTACCAATGGCACCCCTTTACCATCACATCATGCCCC
TTCGACCCTTACGTCTCCGTCCACGTCCGGCAGGTAGGCGACTTCACGCGCGCCCTCGGCGACGCCACCGGTGCC
GGAAGCGCCCAGTCCAAGCTCTACGACAGCGTCGACCCCATGGGCATGTACGAGGTGGCTCTCCAAAACGGCCAG
CAAATGCCGGCCCTCCGGATCGACGGCCCCTTCGGCGCCCCAGCAGAAGACGTCTTCGAAAACGAGATCGCCGTC
CTGATAGGCACCGGCATAGGCGTCACCCCCTGGGCCTCAATCCTCAAGAACATCTGGCACCTCCGCAACTCGCCC
AACCCTCCCACCCGCCTCCGCCGCGTCGAGTTCATCTGGGTCTGTCGCGACACCGGCTCCTTCGAATGGTTCCAA
ACGCTCCTCTCCTCTCTAGAAGACCAATCCAAGGAAGCAGCCCGTCTCCCCGGCTCCTCCGGCGTCGAATTCCTC
AAGATCCATACCTACCTAACGCAGAAGCTCGACATAGACACCACGCAGAATATCGTTCTCAACAGCGTGGGCGCT
CAGCTCGACCCCCTGACGGAGCTCCAGTCGCGCACCAACTTTGGCCGTCCCGACTTTCGTCGCCTCTTTACTACC
ATGCGTAACGGCATCCTTGATCGGACGTATATCAATGGGCTTGAGGGGAGTATAAGGACCAACGTGGGCGTTTAC
TTTTGCGGGCCTTCAGTTGCTGCCCGCGACATCAAAACAGCCTGCAAAACCGCCACAACATCCGAAGTCAGATTC
CGCTTCTGGAAAGAACACTTTTAA
Transcript >Ophcf2|03340
ATGGCGGGAACTTCCAAGCGAATGGCGTTTCTGCGCAAGCAGCTCGCCCCGAACAAGCTCCTCTTCTTCTTTTTC
TTCTGGGGCATCCACTGGGCCATCTTTGCGTACGGATGGTGGAAGCAAGAGTCTGACGCCCGTCTCGCGGGTCTC
AACAAGCTACAATTCTCTGTCTGGATCTCTCGTGGCGCCGGTCTCGTCCTATCGGTAGACGGCATGCTCATCCTC
TTGCCCGTCTGCCGCACCATCATGCGCTGGATCCGGCCCAAACTCCGAATCCTCCCCCTGGACGAGAACCTCTGG
TTTCACCGTCAGCTCGCCTACGCTCTCCTCTTCTTCACCATACTCCACGTGGCAGCGCACTACGTCAACTTCTAC
AACGTTCAGATTACGCAGATCCGGCCGGTGACGGCGCTTCAGATCCACTACGCGCAGCCGGGCGGTATCACAGGC
CACATCATGCTGCTCTGCATGCTCTTCATGTACACGACAGCCCATCACCGGATCCGCCAGCAGTCGTTCGAATCG
TTCTGGTACACGCACCACCTCTTCATCCCCTTTATGCTGGCTCTCTACACCCACACCGTCGGCTGCTTCGTCCGC
GACTCGCCTCTGGGCTTCTCACCCTTCGAGGGCGATCAGTACTGGGAGCACTGCATTGGCTACCTCGGCTGGCGC
TGGGAGATCTGGACGGGCGTTTTGTACACGCTCGAACGGCTATATCGCGAGGTCCGCGCCCGGAGACGGACCTGC
ATCACGCGCATCATCCGTCATCCGTACGACGCCGTCGAGATTCAGTTCAGCAAGCCGTCCTTCAAGTACAAGGCC
GGCCAGTGGCTATTCCTCCAGGTGCCGTCCATCTCCAAGTACCAATGGCACCCCTTTACCATCACATCATGCCCC
TTCGACCCTTACGTCTCCGTCCACGTCCGGCAGGTAGGCGACTTCACGCGCGCCCTCGGCGACGCCACCGGTGCC
GGAAGCGCCCAGTCCAAGCTCTACGACAGCGTCGACCCCATGGGCATGTACGAGGTGGCTCTCCAAAACGGCCAG
CAAATGCCGGCCCTCCGGATCGACGGCCCCTTCGGCGCCCCAGCAGAAGACGTCTTCGAAAACGAGATCGCCGTC
CTGATAGGCACCGGCATAGGCGTCACCCCCTGGGCCTCAATCCTCAAGAACATCTGGCACCTCCGCAACTCGCCC
AACCCTCCCACCCGCCTCCGCCGCGTCGAGTTCATCTGGGTCTGTCGCGACACCGGCTCCTTCGAATGGTTCCAA
ACGCTCCTCTCCTCTCTAGAAGACCAATCCAAGGAAGCAGCCCGTCTCCCCGGCTCCTCCGGCGTCGAATTCCTC
AAGATCCATACCTACCTAACGCAGAAGCTCGACATAGACACCACGCAGAATATCGTTCTCAACAGCGTGGGCGCT
CAGCTCGACCCCCTGACGGAGCTCCAGTCGCGCACCAACTTTGGCCGTCCCGACTTTCGTCGCCTCTTTACTACC
ATGCGTAACGGCATCCTTGATCGGACGTATATCAATGGGCTTGAGGGGAGTATAAGGACCAACGTGGGCGTTTAC
TTTTGCGGGCCTTCAGTTGCTGCCCGCGACATCAAAACAGCCTGCAAAACCGCCACAACATCCGAAGTCAGATTC
CGCTTCTGGAAAGAACACTTTTAA
Gene >Ophcf2|03340
ATGGCGGGAACTTCCAAGCGAATGGCGTTTCTGCGCAAGCAGCTCGCCCCGAACAAGCTCCTCTTCTTCTTTTTC
TTCTGGGGCATCCACTGGGCCATCTTTGCGTACGGATGGTAAGTCGACATCGCCCGTCAAGTTGTTTCTTGTGTT
TCTGCTTCGGTCTAACAGCTATCTCTTAGGTGGAAGCAAGAGTCTGACGCCCGTCTCGCGGGTCTCAACAAGCTA
CAATTCTCTGTCTGGATCTCTCGTGGCGCCGGTCTCGTCCTATCGGTAGACGGCATGCTCATCCTCTTGCCCGTC
TGCCGCACCATCATGCGCTGGATCCGGCCCAAACTCCGAATCCTCCCCCTGGACGAGAACCTCTGGTTTCACCGT
CAGCTCGCCTACGCTCTCCTCTTCTTCACCATACTCCACGTGGCAGCGCACTACGTCAACTTCTACAACGTTCAG
ATTACGCAGATCCGGCCGGTGACGGCGCTTCAGATCCACTACGCGCAGCCGGGCGGTATCACAGGCCACATCATG
CTGCTCTGCATGCTCTTCATGTACACGACAGCCCATCACCGGATCCGCCAGCAGTCGTTCGAATCGTTCTGGTAC
ACGCACCACCTCTTCATCCCCTTTATGCTGGCTCTCTACACCCACACCGTCGGCTGCTTCGTCCGCGACTCGCCT
CTGGGCTTCTCACCCTTCGAGGGCGATCAGTACTGGGAGCACTGCATTGGCTACCTCGGCTGGCGCTGGGAGATC
TGGACGGGCGTTTTGTACACGCTCGAACGGCTATATCGCGAGGTCCGCGCCCGGAGACGGACCTGCATCACGCGC
ATCATCCGTCATCCGTACGACGCCGTCGAGATTCAGTTCAGCAAGCCGTCCTTCAAGTACAAGGCCGGCCAGTGG
CTATTCCTCCAGGTGCCGTCCATCTCCAAGTACCAATGGCACCCCTTTACCATCACATCATGCCCCTTCGACCCT
TACGTCTCCGTCCACGTCCGGCAGGTAGGCGACTTCACGCGCGCCCTCGGCGACGCCACCGGTGCCGGAAGCGCC
CAGTCCAAGCTCTACGACAGCGTCGACCCCATGGGCATGTACGAGGTGGCTCTCCAAAACGGCCAGCAAATGCCG
GCCCTCCGGATCGACGGCCCCTTCGGCGCCCCAGCAGAAGACGTCTTCGAAAACGAGATCGCCGTCCTGATAGGC
ACCGGCATAGGCGTCACCCCCTGGGCCTCAATCCTCAAGAACATCTGGCACCTCCGCAACTCGCCCAACCCTCCC
ACCCGCCTCCGCCGCGTCGAGTTCATCTGGGTCTGTCGCGACACCGGCTCCTTCGAATGGTTCCAAACGCTCCTC
TCCTCTCTAGAAGACCAATCCAAGGAAGCAGCCCGTCTCCCCGGCTCCTCCGGCGTCGAATTCCTCAAGATCCAT
ACCTACCTAACGCAGAAGCTCGACATAGACACCACGCAGAATATCGTTCTCAACAGCGTGGGCGCTCAGCTCGAC
CCCCTGACGGAGCTCCAGTCGCGCACCAACTTTGGCCGTCCCGACTTTCGTCGCCTCTTTACTACCATGCGTAAC
GGCATCCTTGATCGGACGTATATCAATGGGCTTGAGGGGAGTATAAGGACCAACGTGGGCGTTTACTTTTGCGGG
CCTTCAGTTGCTGGTGAGTTTTCCCTTTTTCTTTTCTGCCCTGCTCTCTCCATATACTCTTTCTTCCCCTCTCCT
CTTTCACAATCCCCCCCTTTTTTCCAGACAGATGCTAACGCAAATCCCAGCCCGCGACATCAAAACAGCCTGCAA
AACCGCCACAACATCCGAAGTCAGATTCCGCTTCTGGAAAGAACACTTTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail