Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03335
Gene name
Locationscaffold_03:2396804..2397668
Strand-
Gene length (bp)864
Transcript length (bp)864
Coding sequence length (bp)864
Protein length (aa) 288

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00642 zf-CCCH Zinc finger C-x8-C-x5-C-x3-H type (and similar) 2.5E-04 95 114
PF00642 zf-CCCH Zinc finger C-x8-C-x5-C-x3-H type (and similar) 3.0E-08 120 144
PF14608 zf-CCCH_2 RNA-binding, Nab2-type zinc finger 6.3E-01 96 114
PF14608 zf-CCCH_2 RNA-binding, Nab2-type zinc finger 3.9E-02 124 143
PF14608 zf-CCCH_2 RNA-binding, Nab2-type zinc finger 1.4E+00 152 171
PF14608 zf-CCCH_2 RNA-binding, Nab2-type zinc finger 2.3E+00 177 192

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0005488 binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.3816 0.7532 0.1804 0.0533 0.1657 0.0032 0.0395 0.0081 0.0116 0.0013

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup6400
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2469
Ophiocordyceps australis map64 (Brazil) OphauB2|4471
Ophiocordyceps camponoti-floridani Ophcf2|03335 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6814

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03335
MTEASHGKTMTSTTTSPAKSSASATILRHAAPHTYHFRFTPFLRKTHQVGLPPDRPICKAFQTGSCPHGTRCPER
HVISGEGGRTTQSGGLNSLVCKHWLRGLCKKGEHCEFLHEYNLRKMPECNFFMRNGYCSNGEECLYLHVDPLTRL
PPCPHYDMGFCPLGPLCAKKHVRRKLCPFYLAGFCPDGPDCKQGAHAKWIKDLDKPTAKSDDKKDERDEQYHHHQ
HNRRHHGRPDHLAPRGDDAAADDRSGRDGPRDRDDGGRFGRHGRGGGKWRSGRDRRFRGRGH*
Coding >Ophcf2|03335
ATGACAGAAGCCAGCCACGGAAAGACAATGACATCGACCACGACATCACCAGCCAAATCCTCCGCCAGCGCCACC
ATCCTCCGCCACGCCGCCCCGCACACGTACCACTTCCGCTTCACGCCCTTCCTCCGCAAGACACACCAAGTCGGC
CTGCCCCCCGACCGGCCCATCTGCAAGGCCTTCCAGACGGGCTCATGTCCGCACGGAACGCGCTGTCCAGAGCGC
CACGTGATCTCTGGTGAAGGGGGGCGGACGACGCAGTCAGGGGGGCTTAACTCGCTCGTCTGCAAGCACTGGCTA
CGCGGGCTGTGCAAAAAGGGAGAGCACTGCGAGTTTTTGCACGAGTATAACCTCCGAAAGATGCCTGAGTGTAAC
TTCTTCATGCGCAACGGATACTGCTCCAACGGAGAGGAGTGTCTGTATCTGCACGTCGATCCGCTGACGCGTCTG
CCGCCCTGCCCTCACTACGATATGGGCTTCTGTCCGCTGGGGCCGCTGTGCGCCAAGAAGCATGTTCGCCGCAAG
CTGTGTCCCTTTTACCTCGCCGGCTTCTGCCCAGACGGTCCCGACTGCAAGCAAGGCGCGCATGCAAAGTGGATC
AAGGACCTGGATAAGCCGACGGCCAAGTCGGACGATAAGAAGGACGAGAGGGATGAGCAGTATCATCACCATCAG
CATAACCGACGCCATCACGGGAGACCGGACCATCTGGCGCCGCGTGGAGACGATGCTGCCGCTGATGACCGCTCC
GGTAGGGATGGACCGCGCGATCGCGACGATGGCGGTAGGTTCGGACGCCATGGTCGGGGCGGTGGGAAGTGGAGG
TCTGGAAGGGACAGGCGCTTTCGCGGGAGAGGACATTGA
Transcript >Ophcf2|03335
ATGACAGAAGCCAGCCACGGAAAGACAATGACATCGACCACGACATCACCAGCCAAATCCTCCGCCAGCGCCACC
ATCCTCCGCCACGCCGCCCCGCACACGTACCACTTCCGCTTCACGCCCTTCCTCCGCAAGACACACCAAGTCGGC
CTGCCCCCCGACCGGCCCATCTGCAAGGCCTTCCAGACGGGCTCATGTCCGCACGGAACGCGCTGTCCAGAGCGC
CACGTGATCTCTGGTGAAGGGGGGCGGACGACGCAGTCAGGGGGGCTTAACTCGCTCGTCTGCAAGCACTGGCTA
CGCGGGCTGTGCAAAAAGGGAGAGCACTGCGAGTTTTTGCACGAGTATAACCTCCGAAAGATGCCTGAGTGTAAC
TTCTTCATGCGCAACGGATACTGCTCCAACGGAGAGGAGTGTCTGTATCTGCACGTCGATCCGCTGACGCGTCTG
CCGCCCTGCCCTCACTACGATATGGGCTTCTGTCCGCTGGGGCCGCTGTGCGCCAAGAAGCATGTTCGCCGCAAG
CTGTGTCCCTTTTACCTCGCCGGCTTCTGCCCAGACGGTCCCGACTGCAAGCAAGGCGCGCATGCAAAGTGGATC
AAGGACCTGGATAAGCCGACGGCCAAGTCGGACGATAAGAAGGACGAGAGGGATGAGCAGTATCATCACCATCAG
CATAACCGACGCCATCACGGGAGACCGGACCATCTGGCGCCGCGTGGAGACGATGCTGCCGCTGATGACCGCTCC
GGTAGGGATGGACCGCGCGATCGCGACGATGGCGGTAGGTTCGGACGCCATGGTCGGGGCGGTGGGAAGTGGAGG
TCTGGAAGGGACAGGCGCTTTCGCGGGAGAGGACATTGA
Gene >Ophcf2|03335
ATGACAGAAGCCAGCCACGGAAAGACAATGACATCGACCACGACATCACCAGCCAAATCCTCCGCCAGCGCCACC
ATCCTCCGCCACGCCGCCCCGCACACGTACCACTTCCGCTTCACGCCCTTCCTCCGCAAGACACACCAAGTCGGC
CTGCCCCCCGACCGGCCCATCTGCAAGGCCTTCCAGACGGGCTCATGTCCGCACGGAACGCGCTGTCCAGAGCGC
CACGTGATCTCTGGTGAAGGGGGGCGGACGACGCAGTCAGGGGGGCTTAACTCGCTCGTCTGCAAGCACTGGCTA
CGCGGGCTGTGCAAAAAGGGAGAGCACTGCGAGTTTTTGCACGAGTATAACCTCCGAAAGATGCCTGAGTGTAAC
TTCTTCATGCGCAACGGATACTGCTCCAACGGAGAGGAGTGTCTGTATCTGCACGTCGATCCGCTGACGCGTCTG
CCGCCCTGCCCTCACTACGATATGGGCTTCTGTCCGCTGGGGCCGCTGTGCGCCAAGAAGCATGTTCGCCGCAAG
CTGTGTCCCTTTTACCTCGCCGGCTTCTGCCCAGACGGTCCCGACTGCAAGCAAGGCGCGCATGCAAAGTGGATC
AAGGACCTGGATAAGCCGACGGCCAAGTCGGACGATAAGAAGGACGAGAGGGATGAGCAGTATCATCACCATCAG
CATAACCGACGCCATCACGGGAGACCGGACCATCTGGCGCCGCGTGGAGACGATGCTGCCGCTGATGACCGCTCC
GGTAGGGATGGACCGCGCGATCGCGACGATGGCGGTAGGTTCGGACGCCATGGTCGGGGCGGTGGGAAGTGGAGG
TCTGGAAGGGACAGGCGCTTTCGCGGGAGAGGACATTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail