Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03334
Gene name
Locationscaffold_03:2394908..2396540
Strand+
Gene length (bp)1632
Transcript length (bp)1506
Coding sequence length (bp)1506
Protein length (aa) 502

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08643 DUF1776 Fungal family of unknown function (DUF1776) 1.9E-99 128 434

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Peroxisomal targeting signal 0.185 0.1164 0.2683 0.0319 0.7466 0.138 0.4784 0.2573 0.2845 0.5415

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3146
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2468
Ophiocordyceps australis map64 (Brazil) OphauB2|4470
Ophiocordyceps camponoti-floridani Ophcf2|03334 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6815
Ophiocordyceps kimflemingae Ophio5|5229
Ophiocordyceps subramaniannii Hirsu2|5533

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03334
MSADDQHFLDLLSGVPVHLRRYASDVADFVDRNVDRASLSLRDTFSGSSWIPESIRPDPVPRPSTSAAAAAAASS
RLEVAQRWVARHKFITGLILVVCGSVAYTGYQRSCRRWPRKARRAKRARNGGRVDVVVVAGSPTLPLTKSLSLDL
ERRGFVVFVVCNAAEDENMVHAFSRPDIRPLTIDTTDPPRAGAAIERFARYLQSPQAPGPQVKPNQLTLKSVILI
PSLHYQTSPIATIPPSSFADLFNTHLLQPILTIQAFLPLLTSRLNPVGEKWIPPKVLVFTPSIISSINPPFHAPE
ATVCSALSAFTEVLTAELGPLDIPVTHVQLGTFDFSGFSATGRSYGPLIPTTPHETLVWPDGARHVYGRNYVAQN
TSAISGGRIGGFKGSSLRCLHTTVFDVIDGSITSHSVRVGLGAGIYGFVGRWAPRGLVSWMMGIRRVDELSTWKA
SPDDSAGCSPCSDDPATALSHDFIAVPSEGNVWNTETADSSLWVPSLSETS*
Coding >Ophcf2|03334
ATGTCTGCCGACGATCAGCACTTCCTGGATCTTCTCTCCGGCGTCCCCGTTCACCTCAGACGCTACGCGAGTGAC
GTCGCCGATTTTGTTGACCGGAATGTTGACCGCGCTTCCCTTTCCTTGCGGGATACCTTTTCTGGATCTTCCTGG
ATCCCGGAATCGATAAGACCCGATCCCGTCCCGAGGCCGTCGACGTCCGCCGCAGCCGCCGCAGCCGCCTCGTCG
CGCCTTGAGGTGGCTCAGCGTTGGGTGGCGCGTCACAAGTTCATCACGGGCCTTATCCTCGTTGTCTGTGGCTCT
GTCGCGTATACGGGCTATCAGAGGAGCTGTCGGCGCTGGCCTCGCAAGGCCCGAAGAGCCAAGAGGGCGCGCAAT
GGCGGCCGCGTCGATGTCGTCGTCGTCGCCGGCTCGCCTACCCTGCCTCTGACCAAGTCGCTATCCCTCGACCTG
GAAAGGCGCGGCTTCGTCGTCTTCGTCGTCTGTAATGCAGCCGAGGATGAAAACATGGTACATGCCTTTTCTCGT
CCCGACATCCGGCCTCTCACCATCGACACCACCGACCCTCCTCGCGCTGGCGCAGCCATCGAACGCTTCGCCCGC
TATCTGCAGTCGCCACAGGCCCCCGGCCCTCAGGTTAAACCGAACCAGCTGACGCTCAAGTCGGTCATCCTCATC
CCCAGCCTCCACTACCAGACGTCGCCCATCGCGACGATACCGCCCTCGAGCTTCGCCGACCTTTTCAACACGCAC
CTTCTACAGCCCATTCTCACCATTCAGGCCTTTCTCCCGCTGCTCACGTCGCGGCTGAACCCCGTTGGCGAGAAA
TGGATCCCTCCCAAGGTCCTCGTCTTCACGCCTTCCATCATTTCCTCCATCAACCCGCCTTTTCACGCACCAGAA
GCCACTGTCTGCTCCGCCTTGTCCGCCTTTACAGAGGTGCTGACGGCCGAGCTCGGTCCGCTCGACATACCCGTC
ACCCACGTTCAGCTCGGCACCTTTGACTTTTCCGGCTTCTCGGCCACGGGCCGTTCCTATGGCCCGCTCATACCG
ACAACGCCCCATGAGACCCTTGTGTGGCCCGATGGCGCCCGCCACGTCTACGGCCGCAACTACGTGGCCCAGAAC
ACATCGGCCATCTCGGGCGGTCGCATCGGCGGCTTCAAGGGCAGCTCCCTACGCTGCCTGCACACAACCGTCTTC
GACGTCATCGACGGCTCCATCACCAGTCACTCAGTCCGTGTCGGGCTCGGTGCCGGAATCTATGGCTTTGTCGGT
CGTTGGGCGCCTCGCGGCCTCGTCTCGTGGATGATGGGCATTCGTCGCGTCGATGAGCTGTCAACCTGGAAGGCC
AGTCCAGACGATTCGGCTGGCTGCTCGCCCTGCAGCGATGACCCGGCTACGGCGCTGTCGCACGACTTCATCGCC
GTCCCGTCGGAGGGCAACGTCTGGAACACGGAAACGGCTGATAGCAGCCTCTGGGTTCCATCCCTGTCTGAGACT
TCGTAG
Transcript >Ophcf2|03334
ATGTCTGCCGACGATCAGCACTTCCTGGATCTTCTCTCCGGCGTCCCCGTTCACCTCAGACGCTACGCGAGTGAC
GTCGCCGATTTTGTTGACCGGAATGTTGACCGCGCTTCCCTTTCCTTGCGGGATACCTTTTCTGGATCTTCCTGG
ATCCCGGAATCGATAAGACCCGATCCCGTCCCGAGGCCGTCGACGTCCGCCGCAGCCGCCGCAGCCGCCTCGTCG
CGCCTTGAGGTGGCTCAGCGTTGGGTGGCGCGTCACAAGTTCATCACGGGCCTTATCCTCGTTGTCTGTGGCTCT
GTCGCGTATACGGGCTATCAGAGGAGCTGTCGGCGCTGGCCTCGCAAGGCCCGAAGAGCCAAGAGGGCGCGCAAT
GGCGGCCGCGTCGATGTCGTCGTCGTCGCCGGCTCGCCTACCCTGCCTCTGACCAAGTCGCTATCCCTCGACCTG
GAAAGGCGCGGCTTCGTCGTCTTCGTCGTCTGTAATGCAGCCGAGGATGAAAACATGGTACATGCCTTTTCTCGT
CCCGACATCCGGCCTCTCACCATCGACACCACCGACCCTCCTCGCGCTGGCGCAGCCATCGAACGCTTCGCCCGC
TATCTGCAGTCGCCACAGGCCCCCGGCCCTCAGGTTAAACCGAACCAGCTGACGCTCAAGTCGGTCATCCTCATC
CCCAGCCTCCACTACCAGACGTCGCCCATCGCGACGATACCGCCCTCGAGCTTCGCCGACCTTTTCAACACGCAC
CTTCTACAGCCCATTCTCACCATTCAGGCCTTTCTCCCGCTGCTCACGTCGCGGCTGAACCCCGTTGGCGAGAAA
TGGATCCCTCCCAAGGTCCTCGTCTTCACGCCTTCCATCATTTCCTCCATCAACCCGCCTTTTCACGCACCAGAA
GCCACTGTCTGCTCCGCCTTGTCCGCCTTTACAGAGGTGCTGACGGCCGAGCTCGGTCCGCTCGACATACCCGTC
ACCCACGTTCAGCTCGGCACCTTTGACTTTTCCGGCTTCTCGGCCACGGGCCGTTCCTATGGCCCGCTCATACCG
ACAACGCCCCATGAGACCCTTGTGTGGCCCGATGGCGCCCGCCACGTCTACGGCCGCAACTACGTGGCCCAGAAC
ACATCGGCCATCTCGGGCGGTCGCATCGGCGGCTTCAAGGGCAGCTCCCTACGCTGCCTGCACACAACCGTCTTC
GACGTCATCGACGGCTCCATCACCAGTCACTCAGTCCGTGTCGGGCTCGGTGCCGGAATCTATGGCTTTGTCGGT
CGTTGGGCGCCTCGCGGCCTCGTCTCGTGGATGATGGGCATTCGTCGCGTCGATGAGCTGTCAACCTGGAAGGCC
AGTCCAGACGATTCGGCTGGCTGCTCGCCCTGCAGCGATGACCCGGCTACGGCGCTGTCGCACGACTTCATCGCC
GTCCCGTCGGAGGGCAACGTCTGGAACACGGAAACGGCTGATAGCAGCCTCTGGGTTCCATCCCTGTCTGAGACT
TCGTAG
Gene >Ophcf2|03334
ATGTCTGCCGACGATCAGCACTTCCTGGATCTTGTTCGTTGCCCAAGAATCACCCCGTGACCCATCATCTCTCTC
GCTGACTGACCGGGTCCAAGCTCTCCGGCGTCCCCGTTCACCTCAGACGCTACGCGAGTGACGTCGCCGATTTTG
TTGACCGGAATGTTGACCGCGCTTCCCTTTCCTTGCGGGATACCTTTTCTGGATCTTCCTGGATCCCGGAATCGA
TAAGACCCGATCCCGTCCCGAGGCCGTCGACGTCCGCCGCAGCCGCCGCAGCCGCCTCGTCGCGCCTTGAGGTGG
CTCAGCGTTGGGTGGCGCGTCACAAGTTCATCACGGGCCTTATCCTCGTTGTCTGTGGCTCTGTCGCGTATACGG
GCTATCAGAGGAGCTGTCGGCGCTGGCCTCGCAAGGCCCGAAGAGCCAAGAGGGCGCGCAATGGCGGCCGCGTCG
ATGTCGTCGTCGTCGCCGGCTCGCCTACCCTGCCTCTGACCAAGTCGCTATCCCTCGACCTGGAAAGGCGCGGCT
TCGTCGTCTTCGTCGTCTGTAATGCAGCCGAGGATGAAAACATGGTACATGCCTTTTCTCGTCCCGACATCCGGC
CTCTCACCATCGACACCACCGACGTATGTCCTCCCTCTTTTCCCCCTTCTTCAGGGGCTTCACTGTTGCTCATCA
CCTTCTCTTCAGCCTCCTCGCGCTGGCGCAGCCATCGAACGCTTCGCCCGCTATCTGCAGTCGCCACAGGCCCCC
GGCCCTCAGGTTAAACCGAACCAGCTGACGCTCAAGTCGGTCATCCTCATCCCCAGCCTCCACTACCAGACGTCG
CCCATCGCGACGATACCGCCCTCGAGCTTCGCCGACCTTTTCAACACGCACCTTCTACAGCCCATTCTCACCATT
CAGGCCTTTCTCCCGCTGCTCACGTCGCGGCTGAACCCCGTTGGCGAGAAATGGATCCCTCCCAAGGTCCTCGTC
TTCACGCCTTCCATCATTTCCTCCATCAACCCGCCTTTTCACGCACCAGAAGCCACTGTCTGCTCCGCCTTGTCC
GCCTTTACAGAGGTGCTGACGGCCGAGCTCGGTCCGCTCGACATACCCGTCACCCACGTTCAGCTCGGCACCTTT
GACTTTTCCGGCTTCTCGGCCACGGGCCGTTCCTATGGCCCGCTCATACCGACAACGCCCCATGAGACCCTTGTG
TGGCCCGATGGCGCCCGCCACGTCTACGGCCGCAACTACGTGGCCCAGAACACATCGGCCATCTCGGGCGGTCGC
ATCGGCGGCTTCAAGGGCAGCTCCCTACGCTGCCTGCACACAACCGTCTTCGACGTCATCGACGGCTCCATCACC
AGTCACTCAGTCCGTGTCGGGCTCGGTGCCGGAATCTATGGCTTTGTCGGTCGTTGGGCGCCTCGCGGCCTCGTC
TCGTGGATGATGGGCATTCGTCGCGTCGATGAGCTGTCAACCTGGAAGGCCAGTCCAGACGATTCGGCTGGCTGC
TCGCCCTGCAGCGATGACCCGGCTACGGCGCTGTCGCACGACTTCATCGCCGTCCCGTCGGAGGGCAACGTCTGG
AACACGGAAACGGCTGATAGCAGCCTCTGGGTTCCATCCCTGTCTGAGACTTCGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail