Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03327
Gene name
Locationscaffold_03:2371079..2372958
Strand-
Gene length (bp)1879
Transcript length (bp)1734
Coding sequence length (bp)1734
Protein length (aa) 578

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01545 Cation_efflux Cation efflux family 9.9E-49 16 425

GO

GO Term Description Terminal node
GO:0008324 cation transmembrane transporter activity Yes
GO:0006812 cation transport Yes
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0051234 establishment of localization No
GO:0005575 cellular_component No
GO:0110165 cellular anatomical entity No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0009987 cellular process No
GO:0006811 ion transport No
GO:0006810 transport No
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0015075 ion transmembrane transporter activity No
GO:0022857 transmembrane transporter activity No
GO:0051179 localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 46 0.5

Transmembrane Domains

Domain # Start End Length
1 17 36 19
2 46 65 19
3 86 108 22
4 118 140 22
5 366 388 22
6 403 425 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03327
MAGSSKWAWSKSTRIKVMLVIDTAFFLVELIAGFLASSLALTADAFHMLNDIISLVIGLWAVVAAQKATTDEFTF
GWVRAEILGAFFNAVFLIALCVSIVLEALTRFVEPPDISNPKLILIVGCAGLFSNLLGFFVLGGHGHGHSHEDHG
EEGHDHSHHHVHDHDIEAAAAIANEDGPVNDVLPEAVVSRVTENAERSATDGPETSRRIRFGGETSVHDDSGARG
GRAAAQPRGRRRRQSSKSGHSRFASIEDMSIHPASFRQGILSLAAASSNPSGSAGGDESLQADSDAEADEESPLL
RGSRGNGGTIQVKSAGGCSAAVTKKGRSRRDSSVHDGHHHTFPRKAGHKAGGHGHNHGDMGMNAMVLHVLGDALG
NVGVIITALIIWLTDWPGKAYADPAVSLVITAIILKTSIPLTLATARVLLQATPENISIQEIRQDIERLPGVVSC
HHVHVWQLSDTKVVASLHLQVSFPINTHSGEKYMQLARRARKCLHAYGIHSATIQPEFCLDQTHQHDREAAAMTL
DGVAASSDGVCDTGCLLSCVDDCKAQGCCPGQDASSQASSLRRGSQSSHGEA*
Coding >Ophcf2|03327
ATGGCCGGCTCTTCGAAATGGGCGTGGTCCAAGAGCACCCGTATCAAGGTGATGCTCGTCATCGACACTGCCTTC
TTCCTCGTCGAGCTCATCGCCGGCTTTCTCGCGTCTTCTCTGGCCCTCACCGCCGACGCCTTCCACATGTTGAAT
GATATCATCTCCCTTGTTATTGGCCTGTGGGCAGTCGTTGCCGCGCAAAAGGCGACGACGGATGAGTTCACGTTT
GGCTGGGTGCGCGCCGAAATCCTGGGCGCTTTTTTCAATGCAGTCTTCCTCATCGCTCTCTGCGTCTCCATCGTC
CTCGAGGCTCTCACCCGATTCGTCGAGCCCCCCGACATCAGCAACCCGAAACTCATTCTCATCGTCGGATGCGCC
GGTCTCTTCTCCAACCTGCTGGGCTTCTTTGTTCTCGGCGGCCACGGCCACGGACATTCCCATGAAGACCACGGC
GAAGAGGGTCATGATCACTCTCATCACCACGTTCACGACCACGACATCGAGGCTGCGGCAGCCATTGCCAACGAG
GACGGCCCCGTCAACGATGTCCTGCCCGAGGCCGTCGTCAGTCGCGTCACAGAAAATGCCGAACGATCTGCAACG
GATGGCCCTGAGACATCGCGCCGCATACGGTTCGGTGGCGAGACATCTGTCCATGACGACAGCGGTGCCAGGGGC
GGCCGTGCGGCGGCACAACCCAGGGGACGCCGACGTCGGCAATCCAGTAAGAGTGGACATTCGCGCTTTGCCAGT
ATCGAGGACATGAGCATTCATCCAGCAAGCTTTAGGCAGGGTATCCTCAGTCTCGCGGCCGCGTCGTCCAACCCG
TCGGGATCAGCTGGTGGCGACGAGTCGCTTCAGGCGGACTCTGACGCCGAGGCCGACGAAGAGTCGCCTCTTCTA
AGGGGTTCCAGGGGTAACGGCGGGACGATCCAAGTCAAGTCGGCCGGCGGCTGTTCGGCTGCCGTCACCAAGAAG
GGCCGGTCTCGGCGCGACTCGAGCGTTCACGACGGTCATCACCACACATTTCCCCGCAAGGCAGGCCACAAAGCC
GGTGGTCACGGGCACAACCACGGCGACATGGGCATGAATGCCATGGTGCTGCACGTTCTCGGCGATGCGCTGGGC
AACGTGGGCGTCATCATAACGGCCCTCATCATCTGGCTGACAGACTGGCCGGGCAAAGCCTACGCCGACCCGGCC
GTATCTCTCGTCATCACGGCCATCATACTCAAGACATCGATCCCGCTCACGCTAGCGACGGCACGGGTGTTGCTG
CAGGCGACGCCGGAGAACATCAGCATCCAGGAGATTCGGCAGGACATTGAGCGGCTGCCAGGCGTCGTCAGCTGC
CACCACGTCCACGTATGGCAGCTGTCGGACACCAAGGTGGTGGCAAGCCTGCATCTTCAGGTGTCGTTTCCCATC
AACACGCACAGCGGCGAGAAGTACATGCAGCTGGCCAGACGGGCTCGCAAATGTCTGCACGCGTACGGGATACAC
AGCGCCACGATTCAGCCCGAGTTCTGCCTGGACCAGACGCACCAGCACGACCGCGAGGCGGCCGCCATGACGCTG
GACGGCGTGGCGGCCAGCAGCGACGGCGTCTGCGATACCGGATGCTTGTTATCGTGCGTGGACGACTGCAAGGCG
CAGGGGTGCTGTCCGGGCCAGGACGCATCCTCACAGGCTTCATCTCTGCGTCGGGGTAGCCAATCGTCGCACGGA
GAGGCCTGA
Transcript >Ophcf2|03327
ATGGCCGGCTCTTCGAAATGGGCGTGGTCCAAGAGCACCCGTATCAAGGTGATGCTCGTCATCGACACTGCCTTC
TTCCTCGTCGAGCTCATCGCCGGCTTTCTCGCGTCTTCTCTGGCCCTCACCGCCGACGCCTTCCACATGTTGAAT
GATATCATCTCCCTTGTTATTGGCCTGTGGGCAGTCGTTGCCGCGCAAAAGGCGACGACGGATGAGTTCACGTTT
GGCTGGGTGCGCGCCGAAATCCTGGGCGCTTTTTTCAATGCAGTCTTCCTCATCGCTCTCTGCGTCTCCATCGTC
CTCGAGGCTCTCACCCGATTCGTCGAGCCCCCCGACATCAGCAACCCGAAACTCATTCTCATCGTCGGATGCGCC
GGTCTCTTCTCCAACCTGCTGGGCTTCTTTGTTCTCGGCGGCCACGGCCACGGACATTCCCATGAAGACCACGGC
GAAGAGGGTCATGATCACTCTCATCACCACGTTCACGACCACGACATCGAGGCTGCGGCAGCCATTGCCAACGAG
GACGGCCCCGTCAACGATGTCCTGCCCGAGGCCGTCGTCAGTCGCGTCACAGAAAATGCCGAACGATCTGCAACG
GATGGCCCTGAGACATCGCGCCGCATACGGTTCGGTGGCGAGACATCTGTCCATGACGACAGCGGTGCCAGGGGC
GGCCGTGCGGCGGCACAACCCAGGGGACGCCGACGTCGGCAATCCAGTAAGAGTGGACATTCGCGCTTTGCCAGT
ATCGAGGACATGAGCATTCATCCAGCAAGCTTTAGGCAGGGTATCCTCAGTCTCGCGGCCGCGTCGTCCAACCCG
TCGGGATCAGCTGGTGGCGACGAGTCGCTTCAGGCGGACTCTGACGCCGAGGCCGACGAAGAGTCGCCTCTTCTA
AGGGGTTCCAGGGGTAACGGCGGGACGATCCAAGTCAAGTCGGCCGGCGGCTGTTCGGCTGCCGTCACCAAGAAG
GGCCGGTCTCGGCGCGACTCGAGCGTTCACGACGGTCATCACCACACATTTCCCCGCAAGGCAGGCCACAAAGCC
GGTGGTCACGGGCACAACCACGGCGACATGGGCATGAATGCCATGGTGCTGCACGTTCTCGGCGATGCGCTGGGC
AACGTGGGCGTCATCATAACGGCCCTCATCATCTGGCTGACAGACTGGCCGGGCAAAGCCTACGCCGACCCGGCC
GTATCTCTCGTCATCACGGCCATCATACTCAAGACATCGATCCCGCTCACGCTAGCGACGGCACGGGTGTTGCTG
CAGGCGACGCCGGAGAACATCAGCATCCAGGAGATTCGGCAGGACATTGAGCGGCTGCCAGGCGTCGTCAGCTGC
CACCACGTCCACGTATGGCAGCTGTCGGACACCAAGGTGGTGGCAAGCCTGCATCTTCAGGTGTCGTTTCCCATC
AACACGCACAGCGGCGAGAAGTACATGCAGCTGGCCAGACGGGCTCGCAAATGTCTGCACGCGTACGGGATACAC
AGCGCCACGATTCAGCCCGAGTTCTGCCTGGACCAGACGCACCAGCACGACCGCGAGGCGGCCGCCATGACGCTG
GACGGCGTGGCGGCCAGCAGCGACGGCGTCTGCGATACCGGATGCTTGTTATCGTGCGTGGACGACTGCAAGGCG
CAGGGGTGCTGTCCGGGCCAGGACGCATCCTCACAGGCTTCATCTCTGCGTCGGGGTAGCCAATCGTCGCACGGA
GAGGCCTGA
Gene >Ophcf2|03327
ATGGCCGGCTCTTCGAAATGGGCGTGGTCCAAGAGCACCCGTATCAAGGTGATGCTCGTCATCGACACTGCCTTC
TTCCTCGTCGAGCTCATCGCCGGCTTTCTCGCGTCTTCTCTGGCCCTCACCGCCGACGCCTTCCACATGGTTTGT
CCCGTCCGGCCGTTGAATCGCGTCTGCGTCGCGAAATCCCGTCGCGCGGGCTAATGCGCCGTCGCTTTTAGTTGA
ATGATATCATCTCCCTTGTTATTGGCCTGTGGGCAGTCGTTGCCGCGCAAAAGGCGACGACGGATGAGTTCACGT
TTGGCGTACGTTTCGTGTCACCTATCTCTCCCCTGTTTGCACCCGAGCTGACCGCCTCTCTCGTCTCGACCAGTG
GGTGCGCGCCGAAATCCTGGGCGCTTTTTTCAATGCAGTCTTCCTCATCGCTCTCTGCGTCTCCATCGTCCTCGA
GGCTCTCACCCGATTCGTCGAGCCCCCCGACATCAGCAACCCGAAACTCATTCTCATCGTCGGATGCGCCGGTCT
CTTCTCCAACCTGCTGGGCTTCTTTGTTCTCGGCGGCCACGGCCACGGACATTCCCATGAAGACCACGGCGAAGA
GGGTCATGATCACTCTCATCACCACGTTCACGACCACGACATCGAGGCTGCGGCAGCCATTGCCAACGAGGACGG
CCCCGTCAACGATGTCCTGCCCGAGGCCGTCGTCAGTCGCGTCACAGAAAATGCCGAACGATCTGCAACGGATGG
CCCTGAGACATCGCGCCGCATACGGTTCGGTGGCGAGACATCTGTCCATGACGACAGCGGTGCCAGGGGCGGCCG
TGCGGCGGCACAACCCAGGGGACGCCGACGTCGGCAATCCAGTAAGAGTGGACATTCGCGCTTTGCCAGTATCGA
GGACATGAGCATTCATCCAGCAAGCTTTAGGCAGGGTATCCTCAGTCTCGCGGCCGCGTCGTCCAACCCGTCGGG
ATCAGCTGGTGGCGACGAGTCGCTTCAGGCGGACTCTGACGCCGAGGCCGACGAAGAGTCGCCTCTTCTAAGGGG
TTCCAGGGGTAACGGCGGGACGATCCAAGTCAAGTCGGCCGGCGGCTGTTCGGCTGCCGTCACCAAGAAGGGCCG
GTCTCGGCGCGACTCGAGCGTTCACGACGGTCATCACCACACATTTCCCCGCAAGGCAGGCCACAAAGCCGGTGG
TCACGGGCACAACCACGGCGACATGGGCATGAATGCCATGGTGCTGCACGTTCTCGGCGATGCGCTGGGCAACGT
GGGCGTCATCATAACGGCCCTCATCATCTGGCTGACAGACTGGCCGGGCAAAGCCTACGCCGACCCGGCCGTATC
TCTCGTCATCACGGCCATCATACTCAAGACATCGATCCCGCTCACGCTAGCGACGGCACGGGTGTTGCTGCAGGC
GACGCCGGAGAACATCAGCATCCAGGAGATTCGGCAGGACATTGAGCGGCTGCCAGGCGTCGTCAGCTGCCACCA
CGTCCACGTATGGCAGCTGTCGGACACCAAGGTGGTGGCAAGCCTGCATCTTCAGGTGTCGTTTCCCATCAACAC
GCACAGCGGCGAGAAGTACATGCAGCTGGCCAGACGGGCTCGCAAATGTCTGCACGCGTACGGGATACACAGCGC
CACGATTCAGCCCGAGTTCTGCCTGGACCAGACGCACCAGCACGACCGCGAGGCGGCCGCCATGACGCTGGACGG
CGTGGCGGCCAGCAGCGACGGCGTCTGCGATACCGGATGCTTGTTATCGTGCGTGGACGACTGCAAGGCGCAGGG
GTGCTGTCCGGGCCAGGACGCATCCTCACAGGCTTCATCTCTGCGTCGGGGTAGCCAATCGTCGCACGGAGAGGC
CTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail