Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03322
Gene name
Locationscaffold_03:2355895..2356365
Strand-
Gene length (bp)470
Transcript length (bp)291
Coding sequence length (bp)291
Protein length (aa) 97

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12861 zf-ANAPC11 Anaphase-promoting complex subunit 11 RING-H2 finger 1.7E-44 1 82
PF12678 zf-rbx1 RING-H2 zinc finger domain 2.0E-21 22 78
PF13639 zf-RING_2 Ring finger domain 1.1E-06 34 78
PF13445 zf-RING_UBOX RING-type zinc-finger 1.7E-04 24 69

GO

GO Term Description Terminal node
GO:0005680 anaphase-promoting complex Yes
GO:0008270 zinc ion binding Yes
GO:0061630 ubiquitin protein ligase activity Yes
GO:0031145 anaphase-promoting complex-dependent catabolic process Yes
GO:0097602 cullin family protein binding Yes
GO:0044265 cellular macromolecule catabolic process No
GO:0003824 catalytic activity No
GO:0032991 protein-containing complex No
GO:0043170 macromolecule metabolic process No
GO:0010498 proteasomal protein catabolic process No
GO:0140096 catalytic activity, acting on a protein No
GO:0005488 binding No
GO:0044260 cellular macromolecule metabolic process No
GO:0016740 transferase activity No
GO:0043169 cation binding No
GO:0019538 protein metabolic process No
GO:1901565 organonitrogen compound catabolic process No
GO:0051603 proteolysis involved in protein catabolic process No
GO:0008152 metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0000151 ubiquitin ligase complex No
GO:0009056 catabolic process No
GO:0000152 nuclear ubiquitin ligase complex No
GO:0009987 cellular process No
GO:0019787 ubiquitin-like protein transferase activity No
GO:1990234 transferase complex No
GO:0043632 modification-dependent macromolecule catabolic process No
GO:0044237 cellular metabolic process No
GO:0061659 ubiquitin-like protein ligase activity No
GO:1902494 catalytic complex No
GO:0019941 modification-dependent protein catabolic process No
GO:0006508 proteolysis No
GO:0008150 biological_process No
GO:0043167 ion binding No
GO:0140535 intracellular protein-containing complex No
GO:1901575 organic substance catabolic process No
GO:0004842 ubiquitin-protein transferase activity No
GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process No
GO:0005515 protein binding No
GO:0031461 cullin-RING ubiquitin ligase complex No
GO:0046914 transition metal ion binding No
GO:0044248 cellular catabolic process No
GO:0009057 macromolecule catabolic process No
GO:0003674 molecular_function No
GO:0046872 metal ion binding No
GO:0030163 protein catabolic process No
GO:0140513 nuclear protein-containing complex No
GO:0006807 nitrogen compound metabolic process No
GO:0005575 cellular_component No
GO:0044238 primary metabolic process No
GO:0006511 ubiquitin-dependent protein catabolic process No
GO:0071704 organic substance metabolic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Lysosome/Vacuole Nuclear export signal 0.629 0.5222 0.0298 0.1074 0.1236 0.0126 0.3147 0.7741 0.4393 0.0035

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5040
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3100
Ophiocordyceps australis map64 (Brazil) OphauB2|4483
Ophiocordyceps camponoti-floridani Ophcf2|03322 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4626
Ophiocordyceps kimflemingae Ophio5|5317
Ophiocordyceps subramaniannii Hirsu2|2618

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03322
MKVTITEWNAVATWRWDIPEDDVCGICQVHFDGTCPSCKYPGDDCSLLSGKCGHNFHMHCIMEWIKQDSARGQCP
MCRQPFEWVDQANEAGTSPAE*
Coding >Ophcf2|03322
ATGAAAGTCACCATCACTGAGTGGAACGCCGTTGCCACCTGGCGCTGGGATATTCCCGAGGACGACGTCTGTGGC
ATCTGTCAGGTCCACTTCGACGGCACCTGTCCATCGTGCAAATATCCCGGCGACGATTGCAGCCTACTCTCGGGA
AAATGCGGCCACAACTTTCACATGCACTGCATCATGGAGTGGATTAAGCAGGACTCAGCTCGCGGCCAGTGTCCC
ATGTGTCGTCAGCCTTTCGAATGGGTTGACCAGGCCAACGAAGCCGGCACGTCACCTGCAGAGTGA
Transcript >Ophcf2|03322
ATGAAAGTCACCATCACTGAGTGGAACGCCGTTGCCACCTGGCGCTGGGATATTCCCGAGGACGACGTCTGTGGC
ATCTGTCAGGTCCACTTCGACGGCACCTGTCCATCGTGCAAATATCCCGGCGACGATTGCAGCCTACTCTCGGGA
AAATGCGGCCACAACTTTCACATGCACTGCATCATGGAGTGGATTAAGCAGGACTCAGCTCGCGGCCAGTGTCCC
ATGTGTCGTCAGCCTTTCGAATGGGTTGACCAGGCCAACGAAGCCGGCACGTCACCTGCAGAGTGA
Gene >Ophcf2|03322
ATGAAAGTCACCATCACTGAGTGGAACGCCGTTGCCACCTGGCGCTGGGATATTCCCGAGGACGACGTCTGTGGC
ATCTGTCAGGTCCACTTCGACGGCACCTGTCCATCGTGCAAATATCCCGGCGACGATTGCAGCCTACGTGAGTAT
TCCTCATCTTTCCGACTAGCCTCACACGGCACGATTTTCTGAGGTTGTAATGGGCGTTAGTCTCGGGAAAATGCG
GCCACAACTTTCACATGGTAAGCCCGTCCTCTTCCCGCGTCCTCGTCCCGTCCCCTAACCTGCCGCTGCAGCACT
GCATCATGGAGTGGATTAAGCAGGACTCAGCTCGCGGCCAGTGTCCCATGTGTCGTCAGCGTACGATCCTAATCC
TTCCTCACTACCAAGTCTTCGGTTGCGGCTGACGCACTGCAGCTTTCGAATGGGTTGACCAGGCCAACGAAGCCG
GCACGTCACCTGCAGAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail