Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03316
Gene name
Locationscaffold_03:2342335..2345928
Strand-
Gene length (bp)3593
Transcript length (bp)3528
Coding sequence length (bp)3528
Protein length (aa) 1176

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00122 E1-E2_ATPase E1-E2 ATPase 5.7E-50 559 740
PF00403 HMA Heavy-metal-associated domain 3.2E-12 31 91
PF00403 HMA Heavy-metal-associated domain 4.9E-12 118 178
PF00403 HMA Heavy-metal-associated domain 1.3E-10 203 263
PF00403 HMA Heavy-metal-associated domain 7.7E-06 297 345
PF00702 Hydrolase haloacid dehalogenase-like hydrolase 1.6E-38 760 1031
PF08282 Hydrolase_3 haloacid dehalogenase-like hydrolase 8.1E-05 1002 1051

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 374 396 22
2 406 428 22
3 449 471 22
4 481 498 17
5 662 684 22
6 704 726 22
7 1077 1099 22
8 1104 1126 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03316
MAPSAIAIPPPHSGSARLAVRAGEPPIATTTLRVGGMTCGACVSAVESGFKAVDGVRSVSVSLVMERAVVVHDID
AISADRICEMVEDRGFEAQVLSSDMRSPATKSFAGAGSMASTTVAIEGMTCGACTSAVEGGFKGLPGVESFSISL
LSERAVIEHDPALLTVEQITEIIEDRGFGAQVVTTSTSAAKLPDANLTVATTTIAIEGMTCGACTSAVESGFKGV
DGVLKFNISLLAERAVVTHDTTKLSAAQIAQIIDDRGFDASIVSTVSESRDRSGSFSTAQLSVYGSPDATAAKRL
EDTLRALPGVAAVSLSLANDRLTVTHQPAITGLRAVVEAVEVLGFNALLADGQDNNAQLESLAKTREITEWRSAF
RTSLCFAVPVFVMGMVLPMFMPALDFGAWSLVPGLYLGDVICLFLTIPVQFGIGNRFYVSAYKSIRHGAPTMDVL
VILGTSCAFFFSLLSMMVSLLVPPYSRPSTIFDTSTMLITFITLGRYMENQAKGQTSKALSRLMSLAPSMATIYA
DPIAVEKAAEAWAKSPRGPVTPTTPRIGTTSYDQREVATELLQVGDMVIIRPGDKIPADGAVVRGETYVDESMVT
GEAIPVKKRVGDSVIGGTVNGNGRFDFRVTRAGNDTQLSQIVRLVQDAQTARAPIQQLADTLAGYFVPTIIILGL
CTFISWMVLSHVLPHPPKIFLQNASGGKVMVCVKLCISVIVFACPCALGLATPTAVMVGTGIGAEHGILIKGGGA
LERTTKVTQVVLDKTGTLTHGKMNVARTTLATAWATNDWRTRLWWSVVGLTEMGSEHPIGKALVETARRELGVEP
EGALAGSVDDFELTVGKGVRALVEPHSAGAPIRYRVLAGNVSHLEAHGVEVPREAVEASEELNSATRKKGNKSES
GDAVGDDSDDDEDNKNSTKKAAATTGTTNIFVAIDGQYTGHVCLADTIKEGAAAAVAVLHRMGVKTAMVTGDQPA
TALAVAAAVGIAAQDVFASASPDQKQAMIRELQARGEVVAMVGDGINDSPALATADVGMAMASGTDVAMEAADVV
LMRPSDLMSVPAAMHLTRTIFRRIKMNLAWACLYNVLGLPIAMGFFLPVGLHMHPMMAGFAMACSSVSVVVSSLL
LKFWSRPRWMMLQDGVPERRCRLKSLLWGSDRGVPAEGGYVPLQNIDGEV*
Coding >Ophcf2|03316
ATGGCTCCCTCGGCCATCGCCATCCCGCCGCCGCACTCCGGCTCGGCTCGGCTCGCCGTCAGAGCCGGAGAGCCG
CCTATAGCGACCACCACGCTGCGCGTAGGCGGAATGACCTGCGGCGCATGCGTATCTGCGGTTGAATCTGGCTTC
AAAGCCGTCGACGGCGTTCGAAGCGTTTCCGTTAGCCTCGTAATGGAGCGCGCCGTCGTTGTTCACGATATCGAC
GCCATCTCGGCCGATCGGATCTGCGAGATGGTCGAGGACCGTGGCTTCGAAGCCCAAGTATTGTCATCTGACATG
CGGAGTCCTGCCACCAAGTCGTTCGCTGGCGCTGGATCCATGGCGTCCACAACAGTTGCCATCGAGGGCATGACG
TGCGGCGCCTGCACTTCTGCCGTCGAGGGCGGCTTCAAAGGCTTGCCCGGCGTCGAGAGCTTCAGCATCTCCCTG
CTCTCGGAACGCGCCGTCATCGAGCACGACCCGGCGCTATTGACGGTCGAGCAGATCACCGAGATCATCGAAGAT
CGCGGCTTTGGCGCCCAAGTCGTCACCACCTCCACCTCGGCTGCGAAATTGCCCGACGCTAACCTCACCGTCGCC
ACTACCACCATCGCCATCGAAGGCATGACATGCGGTGCCTGTACCTCGGCGGTCGAGAGTGGTTTCAAGGGTGTC
GACGGTGTGCTCAAATTCAACATCAGCCTGCTGGCGGAGCGCGCCGTCGTCACCCACGACACAACCAAGCTATCG
GCGGCGCAAATCGCGCAGATTATCGACGACCGGGGCTTCGACGCCTCCATCGTCAGCACCGTCTCCGAGTCCCGT
GACCGCAGCGGCAGCTTCTCGACGGCACAGCTCAGCGTCTATGGCAGCCCCGATGCGACGGCGGCCAAGAGGCTC
GAGGATACGCTCAGGGCCCTGCCCGGCGTCGCGGCCGTCTCGCTGAGCCTGGCCAACGATCGGCTCACGGTGACG
CATCAGCCCGCCATCACCGGTCTCCGAGCCGTAGTTGAGGCCGTCGAGGTCCTGGGCTTCAACGCGCTGCTTGCC
GATGGACAGGACAACAACGCCCAGCTCGAGTCGCTGGCCAAGACGCGCGAAATCACAGAGTGGAGATCCGCCTTC
CGCACGTCGCTCTGCTTCGCCGTGCCCGTCTTTGTCATGGGAATGGTGCTGCCCATGTTCATGCCGGCGCTTGAC
TTTGGAGCCTGGTCCCTGGTGCCCGGCCTGTACCTGGGCGACGTCATCTGCCTTTTCCTGACGATACCCGTCCAA
TTCGGCATCGGCAACCGGTTCTACGTGTCGGCCTACAAGTCGATTCGGCACGGCGCTCCCACTATGGACGTGCTC
GTCATCCTCGGCACCTCGTGCGCCTTCTTCTTCAGCCTCCTCTCCATGATGGTCTCGCTGCTGGTGCCGCCGTAC
AGCCGGCCCAGCACCATCTTCGACACGAGCACCATGCTCATAACCTTCATCACCCTCGGCCGCTACATGGAAAAC
CAGGCCAAGGGTCAGACGTCCAAGGCGCTGTCGCGGCTCATGTCGCTGGCGCCGTCGATGGCGACCATCTATGCC
GATCCCATCGCCGTCGAAAAGGCGGCCGAGGCCTGGGCCAAGTCGCCGCGCGGCCCCGTGACGCCGACGACGCCG
CGAATCGGGACGACATCTTATGATCAGAGGGAGGTGGCGACGGAACTGCTACAGGTGGGCGACATGGTCATCATC
CGGCCCGGCGATAAGATCCCGGCCGACGGGGCCGTGGTCCGGGGCGAGACGTACGTGGACGAGAGCATGGTGACG
GGCGAGGCGATACCGGTCAAGAAGCGCGTGGGAGACAGCGTCATCGGCGGCACCGTCAATGGCAACGGCCGGTTC
GACTTTCGCGTGACGAGGGCCGGCAACGATACGCAACTGAGCCAGATAGTACGGCTGGTTCAGGACGCGCAGACG
GCCAGGGCTCCGATCCAGCAGCTGGCCGATACGCTGGCCGGCTACTTTGTGCCAACCATCATCATCCTCGGCCTC
TGCACGTTTATATCATGGATGGTGCTGAGCCACGTGCTGCCACACCCGCCCAAGATCTTTCTACAGAACGCCAGC
GGCGGCAAGGTCATGGTTTGCGTCAAGCTCTGCATCTCGGTCATCGTCTTCGCCTGTCCCTGCGCGCTGGGCCTC
GCGACGCCGACGGCCGTCATGGTGGGCACCGGCATCGGGGCCGAGCACGGCATCCTGATAAAGGGGGGCGGCGCG
CTGGAGAGGACGACCAAGGTGACGCAGGTGGTGTTGGACAAGACGGGCACGCTGACTCACGGCAAGATGAACGTG
GCGAGGACGACTCTGGCGACGGCTTGGGCGACCAACGACTGGCGGACACGGCTCTGGTGGTCGGTTGTGGGCCTC
ACGGAGATGGGCAGCGAGCACCCTATCGGCAAGGCGCTGGTAGAGACAGCCAGACGCGAGCTGGGCGTCGAGCCA
GAGGGCGCGCTGGCCGGCAGCGTAGACGACTTTGAGCTGACGGTCGGCAAGGGCGTACGGGCGCTGGTTGAGCCG
CACTCGGCCGGGGCGCCGATACGATACCGGGTGCTGGCCGGCAACGTCAGCCACCTGGAGGCGCACGGGGTCGAG
GTGCCGAGGGAGGCGGTCGAGGCATCGGAGGAGCTAAACTCGGCGACGAGAAAAAAGGGGAACAAGAGCGAGAGT
GGCGACGCCGTGGGTGACGACAGCGATGATGACGAGGACAACAAGAACAGCACAAAGAAGGCAGCGGCAACGACT
GGGACGACCAACATCTTCGTGGCCATTGACGGGCAGTATACGGGCCACGTGTGCCTCGCCGACACGATCAAGGAG
GGCGCAGCGGCGGCGGTGGCGGTGCTGCATCGCATGGGCGTCAAGACGGCCATGGTGACGGGCGACCAGCCAGCA
ACGGCCCTGGCTGTGGCGGCAGCAGTCGGCATAGCGGCCCAAGACGTCTTCGCCAGCGCCAGCCCGGACCAGAAG
CAAGCCATGATCCGGGAGCTGCAGGCCCGTGGCGAGGTCGTGGCCATGGTGGGAGACGGCATCAACGACTCTCCC
GCCCTGGCAACGGCCGACGTCGGAATGGCCATGGCCAGCGGCACAGACGTGGCCATGGAAGCGGCAGACGTTGTG
CTGATGCGTCCCTCGGACCTGATGAGCGTCCCGGCAGCCATGCACCTGACGCGCACCATCTTCCGCCGCATCAAG
ATGAACCTCGCCTGGGCATGCCTGTACAACGTCCTCGGCCTACCCATCGCAATGGGCTTCTTCCTCCCCGTCGGC
CTACACATGCATCCCATGATGGCCGGCTTCGCCATGGCCTGCAGCAGCGTCAGCGTCGTCGTCAGCAGTCTTCTC
CTCAAGTTCTGGTCGCGCCCTCGGTGGATGATGCTCCAGGACGGTGTCCCCGAGAGGAGGTGTCGCTTGAAGAGT
TTGCTCTGGGGGTCTGACAGGGGGGTTCCGGCCGAGGGGGGATATGTGCCTTTGCAGAATATCGATGGAGAGGTA
TAA
Transcript >Ophcf2|03316
ATGGCTCCCTCGGCCATCGCCATCCCGCCGCCGCACTCCGGCTCGGCTCGGCTCGCCGTCAGAGCCGGAGAGCCG
CCTATAGCGACCACCACGCTGCGCGTAGGCGGAATGACCTGCGGCGCATGCGTATCTGCGGTTGAATCTGGCTTC
AAAGCCGTCGACGGCGTTCGAAGCGTTTCCGTTAGCCTCGTAATGGAGCGCGCCGTCGTTGTTCACGATATCGAC
GCCATCTCGGCCGATCGGATCTGCGAGATGGTCGAGGACCGTGGCTTCGAAGCCCAAGTATTGTCATCTGACATG
CGGAGTCCTGCCACCAAGTCGTTCGCTGGCGCTGGATCCATGGCGTCCACAACAGTTGCCATCGAGGGCATGACG
TGCGGCGCCTGCACTTCTGCCGTCGAGGGCGGCTTCAAAGGCTTGCCCGGCGTCGAGAGCTTCAGCATCTCCCTG
CTCTCGGAACGCGCCGTCATCGAGCACGACCCGGCGCTATTGACGGTCGAGCAGATCACCGAGATCATCGAAGAT
CGCGGCTTTGGCGCCCAAGTCGTCACCACCTCCACCTCGGCTGCGAAATTGCCCGACGCTAACCTCACCGTCGCC
ACTACCACCATCGCCATCGAAGGCATGACATGCGGTGCCTGTACCTCGGCGGTCGAGAGTGGTTTCAAGGGTGTC
GACGGTGTGCTCAAATTCAACATCAGCCTGCTGGCGGAGCGCGCCGTCGTCACCCACGACACAACCAAGCTATCG
GCGGCGCAAATCGCGCAGATTATCGACGACCGGGGCTTCGACGCCTCCATCGTCAGCACCGTCTCCGAGTCCCGT
GACCGCAGCGGCAGCTTCTCGACGGCACAGCTCAGCGTCTATGGCAGCCCCGATGCGACGGCGGCCAAGAGGCTC
GAGGATACGCTCAGGGCCCTGCCCGGCGTCGCGGCCGTCTCGCTGAGCCTGGCCAACGATCGGCTCACGGTGACG
CATCAGCCCGCCATCACCGGTCTCCGAGCCGTAGTTGAGGCCGTCGAGGTCCTGGGCTTCAACGCGCTGCTTGCC
GATGGACAGGACAACAACGCCCAGCTCGAGTCGCTGGCCAAGACGCGCGAAATCACAGAGTGGAGATCCGCCTTC
CGCACGTCGCTCTGCTTCGCCGTGCCCGTCTTTGTCATGGGAATGGTGCTGCCCATGTTCATGCCGGCGCTTGAC
TTTGGAGCCTGGTCCCTGGTGCCCGGCCTGTACCTGGGCGACGTCATCTGCCTTTTCCTGACGATACCCGTCCAA
TTCGGCATCGGCAACCGGTTCTACGTGTCGGCCTACAAGTCGATTCGGCACGGCGCTCCCACTATGGACGTGCTC
GTCATCCTCGGCACCTCGTGCGCCTTCTTCTTCAGCCTCCTCTCCATGATGGTCTCGCTGCTGGTGCCGCCGTAC
AGCCGGCCCAGCACCATCTTCGACACGAGCACCATGCTCATAACCTTCATCACCCTCGGCCGCTACATGGAAAAC
CAGGCCAAGGGTCAGACGTCCAAGGCGCTGTCGCGGCTCATGTCGCTGGCGCCGTCGATGGCGACCATCTATGCC
GATCCCATCGCCGTCGAAAAGGCGGCCGAGGCCTGGGCCAAGTCGCCGCGCGGCCCCGTGACGCCGACGACGCCG
CGAATCGGGACGACATCTTATGATCAGAGGGAGGTGGCGACGGAACTGCTACAGGTGGGCGACATGGTCATCATC
CGGCCCGGCGATAAGATCCCGGCCGACGGGGCCGTGGTCCGGGGCGAGACGTACGTGGACGAGAGCATGGTGACG
GGCGAGGCGATACCGGTCAAGAAGCGCGTGGGAGACAGCGTCATCGGCGGCACCGTCAATGGCAACGGCCGGTTC
GACTTTCGCGTGACGAGGGCCGGCAACGATACGCAACTGAGCCAGATAGTACGGCTGGTTCAGGACGCGCAGACG
GCCAGGGCTCCGATCCAGCAGCTGGCCGATACGCTGGCCGGCTACTTTGTGCCAACCATCATCATCCTCGGCCTC
TGCACGTTTATATCATGGATGGTGCTGAGCCACGTGCTGCCACACCCGCCCAAGATCTTTCTACAGAACGCCAGC
GGCGGCAAGGTCATGGTTTGCGTCAAGCTCTGCATCTCGGTCATCGTCTTCGCCTGTCCCTGCGCGCTGGGCCTC
GCGACGCCGACGGCCGTCATGGTGGGCACCGGCATCGGGGCCGAGCACGGCATCCTGATAAAGGGGGGCGGCGCG
CTGGAGAGGACGACCAAGGTGACGCAGGTGGTGTTGGACAAGACGGGCACGCTGACTCACGGCAAGATGAACGTG
GCGAGGACGACTCTGGCGACGGCTTGGGCGACCAACGACTGGCGGACACGGCTCTGGTGGTCGGTTGTGGGCCTC
ACGGAGATGGGCAGCGAGCACCCTATCGGCAAGGCGCTGGTAGAGACAGCCAGACGCGAGCTGGGCGTCGAGCCA
GAGGGCGCGCTGGCCGGCAGCGTAGACGACTTTGAGCTGACGGTCGGCAAGGGCGTACGGGCGCTGGTTGAGCCG
CACTCGGCCGGGGCGCCGATACGATACCGGGTGCTGGCCGGCAACGTCAGCCACCTGGAGGCGCACGGGGTCGAG
GTGCCGAGGGAGGCGGTCGAGGCATCGGAGGAGCTAAACTCGGCGACGAGAAAAAAGGGGAACAAGAGCGAGAGT
GGCGACGCCGTGGGTGACGACAGCGATGATGACGAGGACAACAAGAACAGCACAAAGAAGGCAGCGGCAACGACT
GGGACGACCAACATCTTCGTGGCCATTGACGGGCAGTATACGGGCCACGTGTGCCTCGCCGACACGATCAAGGAG
GGCGCAGCGGCGGCGGTGGCGGTGCTGCATCGCATGGGCGTCAAGACGGCCATGGTGACGGGCGACCAGCCAGCA
ACGGCCCTGGCTGTGGCGGCAGCAGTCGGCATAGCGGCCCAAGACGTCTTCGCCAGCGCCAGCCCGGACCAGAAG
CAAGCCATGATCCGGGAGCTGCAGGCCCGTGGCGAGGTCGTGGCCATGGTGGGAGACGGCATCAACGACTCTCCC
GCCCTGGCAACGGCCGACGTCGGAATGGCCATGGCCAGCGGCACAGACGTGGCCATGGAAGCGGCAGACGTTGTG
CTGATGCGTCCCTCGGACCTGATGAGCGTCCCGGCAGCCATGCACCTGACGCGCACCATCTTCCGCCGCATCAAG
ATGAACCTCGCCTGGGCATGCCTGTACAACGTCCTCGGCCTACCCATCGCAATGGGCTTCTTCCTCCCCGTCGGC
CTACACATGCATCCCATGATGGCCGGCTTCGCCATGGCCTGCAGCAGCGTCAGCGTCGTCGTCAGCAGTCTTCTC
CTCAAGTTCTGGTCGCGCCCTCGGTGGATGATGCTCCAGGACGGTGTCCCCGAGAGGAGGTGTCGCTTGAAGAGT
TTGCTCTGGGGGTCTGACAGGGGGGTTCCGGCCGAGGGGGGATATGTGCCTTTGCAGAATATCGATGGAGAGGTA
TAA
Gene >Ophcf2|03316
ATGGCTCCCTCGGCCATCGCCATCCCGCCGCCGCACTCCGGCTCGGCTCGGCTCGCCGTCAGAGCCGGAGAGCCG
CCTATAGCGACCACCACGCTGCGCGTAGGCGGAATGACGTGAGCAATGTCGATGCAACCTTGCATAGTTAGAACG
AGTAAGCTGACAGACACCATCCTTCCAGCTGCGGCGCATGCGTATCTGCGGTTGAATCTGGCTTCAAAGCCGTCG
ACGGCGTTCGAAGCGTTTCCGTTAGCCTCGTAATGGAGCGCGCCGTCGTTGTTCACGATATCGACGCCATCTCGG
CCGATCGGATCTGCGAGATGGTCGAGGACCGTGGCTTCGAAGCCCAAGTATTGTCATCTGACATGCGGAGTCCTG
CCACCAAGTCGTTCGCTGGCGCTGGATCCATGGCGTCCACAACAGTTGCCATCGAGGGCATGACGTGCGGCGCCT
GCACTTCTGCCGTCGAGGGCGGCTTCAAAGGCTTGCCCGGCGTCGAGAGCTTCAGCATCTCCCTGCTCTCGGAAC
GCGCCGTCATCGAGCACGACCCGGCGCTATTGACGGTCGAGCAGATCACCGAGATCATCGAAGATCGCGGCTTTG
GCGCCCAAGTCGTCACCACCTCCACCTCGGCTGCGAAATTGCCCGACGCTAACCTCACCGTCGCCACTACCACCA
TCGCCATCGAAGGCATGACATGCGGTGCCTGTACCTCGGCGGTCGAGAGTGGTTTCAAGGGTGTCGACGGTGTGC
TCAAATTCAACATCAGCCTGCTGGCGGAGCGCGCCGTCGTCACCCACGACACAACCAAGCTATCGGCGGCGCAAA
TCGCGCAGATTATCGACGACCGGGGCTTCGACGCCTCCATCGTCAGCACCGTCTCCGAGTCCCGTGACCGCAGCG
GCAGCTTCTCGACGGCACAGCTCAGCGTCTATGGCAGCCCCGATGCGACGGCGGCCAAGAGGCTCGAGGATACGC
TCAGGGCCCTGCCCGGCGTCGCGGCCGTCTCGCTGAGCCTGGCCAACGATCGGCTCACGGTGACGCATCAGCCCG
CCATCACCGGTCTCCGAGCCGTAGTTGAGGCCGTCGAGGTCCTGGGCTTCAACGCGCTGCTTGCCGATGGACAGG
ACAACAACGCCCAGCTCGAGTCGCTGGCCAAGACGCGCGAAATCACAGAGTGGAGATCCGCCTTCCGCACGTCGC
TCTGCTTCGCCGTGCCCGTCTTTGTCATGGGAATGGTGCTGCCCATGTTCATGCCGGCGCTTGACTTTGGAGCCT
GGTCCCTGGTGCCCGGCCTGTACCTGGGCGACGTCATCTGCCTTTTCCTGACGATACCCGTCCAATTCGGCATCG
GCAACCGGTTCTACGTGTCGGCCTACAAGTCGATTCGGCACGGCGCTCCCACTATGGACGTGCTCGTCATCCTCG
GCACCTCGTGCGCCTTCTTCTTCAGCCTCCTCTCCATGATGGTCTCGCTGCTGGTGCCGCCGTACAGCCGGCCCA
GCACCATCTTCGACACGAGCACCATGCTCATAACCTTCATCACCCTCGGCCGCTACATGGAAAACCAGGCCAAGG
GTCAGACGTCCAAGGCGCTGTCGCGGCTCATGTCGCTGGCGCCGTCGATGGCGACCATCTATGCCGATCCCATCG
CCGTCGAAAAGGCGGCCGAGGCCTGGGCCAAGTCGCCGCGCGGCCCCGTGACGCCGACGACGCCGCGAATCGGGA
CGACATCTTATGATCAGAGGGAGGTGGCGACGGAACTGCTACAGGTGGGCGACATGGTCATCATCCGGCCCGGCG
ATAAGATCCCGGCCGACGGGGCCGTGGTCCGGGGCGAGACGTACGTGGACGAGAGCATGGTGACGGGCGAGGCGA
TACCGGTCAAGAAGCGCGTGGGAGACAGCGTCATCGGCGGCACCGTCAATGGCAACGGCCGGTTCGACTTTCGCG
TGACGAGGGCCGGCAACGATACGCAACTGAGCCAGATAGTACGGCTGGTTCAGGACGCGCAGACGGCCAGGGCTC
CGATCCAGCAGCTGGCCGATACGCTGGCCGGCTACTTTGTGCCAACCATCATCATCCTCGGCCTCTGCACGTTTA
TATCATGGATGGTGCTGAGCCACGTGCTGCCACACCCGCCCAAGATCTTTCTACAGAACGCCAGCGGCGGCAAGG
TCATGGTTTGCGTCAAGCTCTGCATCTCGGTCATCGTCTTCGCCTGTCCCTGCGCGCTGGGCCTCGCGACGCCGA
CGGCCGTCATGGTGGGCACCGGCATCGGGGCCGAGCACGGCATCCTGATAAAGGGGGGCGGCGCGCTGGAGAGGA
CGACCAAGGTGACGCAGGTGGTGTTGGACAAGACGGGCACGCTGACTCACGGCAAGATGAACGTGGCGAGGACGA
CTCTGGCGACGGCTTGGGCGACCAACGACTGGCGGACACGGCTCTGGTGGTCGGTTGTGGGCCTCACGGAGATGG
GCAGCGAGCACCCTATCGGCAAGGCGCTGGTAGAGACAGCCAGACGCGAGCTGGGCGTCGAGCCAGAGGGCGCGC
TGGCCGGCAGCGTAGACGACTTTGAGCTGACGGTCGGCAAGGGCGTACGGGCGCTGGTTGAGCCGCACTCGGCCG
GGGCGCCGATACGATACCGGGTGCTGGCCGGCAACGTCAGCCACCTGGAGGCGCACGGGGTCGAGGTGCCGAGGG
AGGCGGTCGAGGCATCGGAGGAGCTAAACTCGGCGACGAGAAAAAAGGGGAACAAGAGCGAGAGTGGCGACGCCG
TGGGTGACGACAGCGATGATGACGAGGACAACAAGAACAGCACAAAGAAGGCAGCGGCAACGACTGGGACGACCA
ACATCTTCGTGGCCATTGACGGGCAGTATACGGGCCACGTGTGCCTCGCCGACACGATCAAGGAGGGCGCAGCGG
CGGCGGTGGCGGTGCTGCATCGCATGGGCGTCAAGACGGCCATGGTGACGGGCGACCAGCCAGCAACGGCCCTGG
CTGTGGCGGCAGCAGTCGGCATAGCGGCCCAAGACGTCTTCGCCAGCGCCAGCCCGGACCAGAAGCAAGCCATGA
TCCGGGAGCTGCAGGCCCGTGGCGAGGTCGTGGCCATGGTGGGAGACGGCATCAACGACTCTCCCGCCCTGGCAA
CGGCCGACGTCGGAATGGCCATGGCCAGCGGCACAGACGTGGCCATGGAAGCGGCAGACGTTGTGCTGATGCGTC
CCTCGGACCTGATGAGCGTCCCGGCAGCCATGCACCTGACGCGCACCATCTTCCGCCGCATCAAGATGAACCTCG
CCTGGGCATGCCTGTACAACGTCCTCGGCCTACCCATCGCAATGGGCTTCTTCCTCCCCGTCGGCCTACACATGC
ATCCCATGATGGCCGGCTTCGCCATGGCCTGCAGCAGCGTCAGCGTCGTCGTCAGCAGTCTTCTCCTCAAGTTCT
GGTCGCGCCCTCGGTGGATGATGCTCCAGGACGGTGTCCCCGAGAGGAGGTGTCGCTTGAAGAGTTTGCTCTGGG
GGTCTGACAGGGGGGTTCCGGCCGAGGGGGGATATGTGCCTTTGCAGAATATCGATGGAGAGGTATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail